KEGG   Mesorhizobium loti: mlr4882Help
Entry
mlr4882           CDS       T00043                                 

Definition
pyrazinamidase/nicotinamidase
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
mlo  Mesorhizobium loti
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mlo00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    mlr4882
Enzymes [BR:mlo01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     mlr4882
    3.5.1.-  
     mlr4882
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
3878049..3878663
Genome map
AA seq 204 aa AA seqDB search
MADQALVVIDLQNDFCPGGALAVTGGDEIVPLVNDMIRRTDHVVLTQDWHPAGHSSFASS
HPGAQPFTMIEMPYGQQTLWPDHCIQGSLGSDFHSGLAWTKAELVIRKGFRPDIDSYSAF
FENDHTTPTGLGGYLRERGIDTVTLVGLATDFCVGFSALDAVSQGFKTTVRLDACRGIDL
NGSLEAMLRRMRDAGVALEDHLSD
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atggccgaccaagcgcttgttgtgatcgacctgcagaacgacttttgcccgggcggcgca
ttggccgtgaccggcggcgacgagatcgtgccgctggtcaatgacatgatccggcgcacc
gaccatgtcgtgctgacgcaggactggcatcccgccggccattcgagcttcgcctccagc
catccgggcgcgcagcccttcaccatgatcgaaatgccctacggtcagcagaccttgtgg
ccggatcattgcatccagggcagcctcggctcggatttccattccggccttgcctggacc
aaggccgagctcgtcatccgcaagggctttcgccctgatatagacagctattcggccttc
ttcgagaacgaccacacgacgccgaccggcctcggtggctacctcagggagcgcggtatc
gacaccgtcaccctggtcgggctggcgaccgatttctgcgtcggcttttcggcgctggac
gccgtcagccagggtttcaagaccaccgtgcggctcgacgcctgccgcggcatcgatctc
aatggctcgctcgaagccatgctgcggcgcatgcgcgatgccggcgtggcgctcgaagac
catttgtcggactga

DBGET integrated database retrieval system