KEGG   Mesorhizobium japonicum MAFF 303099: mlr4905Help
Entry
mlr4905           CDS       T00043                                 

Definition
(GenBank) cytochrome c-1
  KO
K08738  cytochrome c
Organism
mlo  Mesorhizobium japonicum MAFF 303099
Pathway
mlo02020  Two-component system
Brite
KEGG Orthology (KO) [BR:mlo00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    mlr4905
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3
Motif
Other DBs
NCBI-ProteinID: BAB51455
RhizoBase: mlr4905
UniProt: Q98D16
Position
3894735..3895085
Genome map
AA seq 116 aa AA seqDB search
MTAARAASVALPKGDAISGRGYFEDRCTGCHSIVRNGFGPRLGDVYGRRVGSVAGFQYSQ
ALRQKRFVWSEKSLDSWLSGPGQFLPGTRMGISIADQQIRADIIAYLKSHPSGQDE
NT seq 351 nt NT seq  +upstreamnt  +downstreamnt
ttgactgctgcccgggcggcatctgtcgccctgcctaagggagatgccatcagcgggcgt
gggtatttcgaggaccgttgcaccggctgccattcgattgtccgaaacggcttcggccct
cgccttggcgatgtctacggcagacgcgtgggatcagttgccggatttcaatacagccag
gcgctgcggcaaaagcgattcgtctggtcggaaaagtcgctcgacagctggctgtccggc
cccgggcaattcctgcccgggacgcggatgggcatctcgatagcagatcagcaaatccgc
gcggatatcatcgcctatctcaaatctcatccgtccggacaggacgaatga

DBGET integrated database retrieval system