KEGG   Mesorhizobium loti: mlr5036Help
Entry
mlr5036           CDS       T00043                                 

Definition
xylose isomerase (EC:5.3.1.5)
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
mlo  Mesorhizobium loti
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mlo00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    mlr5036
   00051 Fructose and mannose metabolism
    mlr5036
Enzymes [BR:mlo01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.5  xylose isomerase
     mlr5036
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
3985893..3987218
Genome map
AA seq 441 aa AA seqDB search
MSSGFFGDIQKIKYEGPDSTNPLAYRFYNPDEVVAGKRLEDHLRFAVAYWHSFAWPGGDP
FGGQTFDRPWFPKAGGIDTMELAKLKADVAFEMFSLLGAPYFCFHDADVRPEGKDFSESA
ARLDEIADYFAGKMKQTGVKLLWGTANLFSHRRFMSGAATNPDPDVFAYAAATVKSCIDV
TKRLKGENYVLWGGREGYETLLNTDLAREQEQAGRFLSLVVDYKHKIGFKGTILIEPKPQ
EPTKHQYDYDVATVYGFLKRFGLEKEVKLNIEQGHAILAGHSFEHELALANALGVFGSID
MNRNDYQSGWDTDQFPNNVPEMALAYYQILQAGGFKTGGTNFDAKLRRQSLDPQDLLIGH
IGGMDACARGLKAAARMVEDKALSAPLAERYAGWNSAEGKAMLSGKRTLEDIAERVVKKK
IEPQPRSGRQELLENIVNRYV
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atgagcagcggatttttcggcgacatccagaagatcaaatatgaggggccggattcgacc
aatccgctggcctaccgcttctacaatccggacgaggtggtggccggcaagcggctggaa
gaccatctgcgcttcgctgtcgcctactggcattccttcgcctggccgggtggcgacccc
ttcggcggccagaccttcgaccgcccctggttccccaaggctggcggcatcgacacgatg
gaactggcgaagctcaaggccgatgttgccttcgagatgttctcgctgctcggcgcgccc
tatttctgcttccacgacgccgacgtccgccccgagggcaaggacttttccgaaagtgcc
gcccgcctcgacgagatcgcggactactttgccggcaagatgaagcagaccggggtcaag
ctgctctggggtaccgcgaacctcttctcgcaccgccgcttcatgtcaggcgccgccacc
aatcccgatccggatgtctttgcctatgcggcggcgacggtgaaaagctgcatcgacgtc
accaagcggctgaaaggcgagaactatgtgctgtggggcgggcgcgaaggctatgagacg
ctgctcaacaccgaccttgcccgcgagcaggaacaggcgggccgcttcctcagcctcgtc
gtcgactacaagcacaagatcggtttcaagggcaccatcctgatcgagccgaagccgcag
gagccgacaaagcatcagtacgactatgacgtcgcaaccgtctatggcttcctcaagcgc
ttcggcctggagaaggaggtcaagctcaacatcgagcagggccacgccatccttgccggc
cactccttcgagcacgagctggcgctcgccaatgccctcggcgtcttcggttcgatcgat
atgaaccgcaacgactaccagtcgggctgggacaccgaccagttccccaacaacgtgccg
gaaatggcgctggcctactaccagatcctgcaggccggtggcttcaagaccggcggcacc
aatttcgacgccaagctgcgccgccagtcgctcgacccgcaggacctgctgatcggccat
atcggcggcatggatgcctgcgcacgcggtctcaaggccgcggcccgcatggtcgaggac
aaggcgctgtcggcgccgctggccgagcgctatgccggttggaactcggcagagggcaag
gcgatgctgtcaggcaagcgcacgctggaggacatcgccgagcgcgtggtcaagaagaag
atcgaaccgcagccgcgctccggccgccaggaattgctggaaaacatcgtcaaccgctac
gtctga

DBGET integrated database retrieval system