KEGG   Mesorhizobium loti: mlr5071Help
Entry
mlr5071           CDS       T00043                                 

Definition
(GenBank) tryptophan synthase beta subunit
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
mlo  Mesorhizobium loti
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mlo00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    mlr5071
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    mlr5071
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    mlr5071
Enzymes [BR:mlo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     mlr5071
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
RhizoBase: 
UniProt: 
Position
4014688..4015938
Genome map
AA seq 416 aa AA seqDB search
MDQPATPNSFRTGPDEQGMFGIFGGRFVAETLMPLILDLERHWNEVKNDPDFRAELTDLS
THYAGRPSKLYFAEGLTKHLREVSSAKGLGGGAKVYFKREDLNHTGSHKINNCLGQILLA
KRMGKKRIIAETGAGQHGVASATVAARFGYPCVVYMGATDVARQSPNVFRMKLLGAEVRP
VTAGHGTLKDAMNEALRDWVTNVEDTYYLIGTAAGPHPYPELVRDFQSVIGTEARAQILE
QEGRLPDTIIAAVGGGSNAIGLFHPFLDDKDVRIIGIEAGGRGLDGIEHCASMNAGSPGV
LHGNRTYLLQNADGQIMDGHSISAGLDYPGVGPEHSWLRDSGRVEYVPILDDEALEAFKL
TTRVEGIIPALESAHAIAHAVKIVPAMDKDQIVIVNLSGRGDKDVHTVASMLGMEI
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atggaccagccggcgacgcccaattccttccgcaccggacccgacgagcagggcatgttc
ggcattttcggcggccgtttcgtcgcagaaacgctgatgccgctgatcctcgacctggag
cggcactggaacgaggtcaagaacgatccggatttcagggctgagctgaccgatctttcg
acccactatgccggacgcccgtcgaagctctatttcgccgagggtcttacgaagcatctt
cgcgaggtttcctcggcgaagggcctcgggggcggcgccaaagtctatttcaagcgcgag
gacctgaaccacaccgggtcgcacaagatcaacaactgcctcggccagatcctgctggcc
aagcgcatgggcaagaagcgcatcatcgccgagacaggcgccggccagcatggcgtggca
tccgccaccgtcgccgcccgcttcggctatccctgcgtcgtctacatgggcgccaccgac
gttgcccggcagagcccgaacgtgtttcgcatgaagctgctcggcgccgaagtgcggccg
gtcaccgctggccacggcacgctgaaggacgccatgaacgaagcccttcgcgattgggtc
accaatgtcgaggacacctattatcttatcggcacagccgcaggcccgcatccctatccg
gagctggtgcgcgacttccagtcggtgatcggcaccgaggcgcgcgcgcaaatcctcgaa
caggaaggccggctgcccgacaccatcattgccgctgtcggcggcggctcgaatgccatc
ggtctgttccatcccttcctcgacgacaaggacgtgcgcatcatcggcatcgaagccggc
gggcgcggcctcgacggcatcgagcactgcgcctcgatgaatgccggttctcccggcgtg
ctgcacggcaaccgcacctatctcctgcagaatgccgacggccagatcatggacggccat
tcgatctcggccggcctcgactatcccggcgtcggcccggagcattcctggctgcgcgat
tccggccgcgtcgaatatgtgccgatcctcgacgacgaggcgctggaagccttcaagctg
acgacgcgcgtcgaaggcatcatcccggcgctggaatccgcgcacgccatcgcccacgcg
gtgaagatcgtgcctgccatggacaaggaccagatcgtcatcgtcaacctgtccggccgt
ggcgacaaggacgtgcacacggtggcctcgatgctgggcatggagatctag

DBGET integrated database retrieval system