KEGG   Mesorhizobium japonicum MAFF 303099: mlr5071Help
Entry
mlr5071           CDS       T00043                                 

Definition
(GenBank) tryptophan synthase beta subunit
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
mlo  Mesorhizobium japonicum MAFF 303099
Pathway
mlo00260  Glycine, serine and threonine metabolism
mlo00400  Phenylalanine, tyrosine and tryptophan biosynthesis
mlo01100  Metabolic pathways
mlo01110  Biosynthesis of secondary metabolites
mlo01130  Biosynthesis of antibiotics
mlo01230  Biosynthesis of amino acids
Module
mlo_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mlo00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    mlr5071
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    mlr5071
Enzymes [BR:mlo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     mlr5071
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP Tom7
Motif
Other DBs
NCBI-ProteinID: BAB51584
RhizoBase: mlr5071
UniProt: Q98CN7
Position
4014688..4015938
Genome map
AA seq 416 aa AA seqDB search
MDQPATPNSFRTGPDEQGMFGIFGGRFVAETLMPLILDLERHWNEVKNDPDFRAELTDLS
THYAGRPSKLYFAEGLTKHLREVSSAKGLGGGAKVYFKREDLNHTGSHKINNCLGQILLA
KRMGKKRIIAETGAGQHGVASATVAARFGYPCVVYMGATDVARQSPNVFRMKLLGAEVRP
VTAGHGTLKDAMNEALRDWVTNVEDTYYLIGTAAGPHPYPELVRDFQSVIGTEARAQILE
QEGRLPDTIIAAVGGGSNAIGLFHPFLDDKDVRIIGIEAGGRGLDGIEHCASMNAGSPGV
LHGNRTYLLQNADGQIMDGHSISAGLDYPGVGPEHSWLRDSGRVEYVPILDDEALEAFKL
TTRVEGIIPALESAHAIAHAVKIVPAMDKDQIVIVNLSGRGDKDVHTVASMLGMEI
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atggaccagccggcgacgcccaattccttccgcaccggacccgacgagcagggcatgttc
ggcattttcggcggccgtttcgtcgcagaaacgctgatgccgctgatcctcgacctggag
cggcactggaacgaggtcaagaacgatccggatttcagggctgagctgaccgatctttcg
acccactatgccggacgcccgtcgaagctctatttcgccgagggtcttacgaagcatctt
cgcgaggtttcctcggcgaagggcctcgggggcggcgccaaagtctatttcaagcgcgag
gacctgaaccacaccgggtcgcacaagatcaacaactgcctcggccagatcctgctggcc
aagcgcatgggcaagaagcgcatcatcgccgagacaggcgccggccagcatggcgtggca
tccgccaccgtcgccgcccgcttcggctatccctgcgtcgtctacatgggcgccaccgac
gttgcccggcagagcccgaacgtgtttcgcatgaagctgctcggcgccgaagtgcggccg
gtcaccgctggccacggcacgctgaaggacgccatgaacgaagcccttcgcgattgggtc
accaatgtcgaggacacctattatcttatcggcacagccgcaggcccgcatccctatccg
gagctggtgcgcgacttccagtcggtgatcggcaccgaggcgcgcgcgcaaatcctcgaa
caggaaggccggctgcccgacaccatcattgccgctgtcggcggcggctcgaatgccatc
ggtctgttccatcccttcctcgacgacaaggacgtgcgcatcatcggcatcgaagccggc
gggcgcggcctcgacggcatcgagcactgcgcctcgatgaatgccggttctcccggcgtg
ctgcacggcaaccgcacctatctcctgcagaatgccgacggccagatcatggacggccat
tcgatctcggccggcctcgactatcccggcgtcggcccggagcattcctggctgcgcgat
tccggccgcgtcgaatatgtgccgatcctcgacgacgaggcgctggaagccttcaagctg
acgacgcgcgtcgaaggcatcatcccggcgctggaatccgcgcacgccatcgcccacgcg
gtgaagatcgtgcctgccatggacaaggaccagatcgtcatcgtcaacctgtccggccgt
ggcgacaaggacgtgcacacggtggcctcgatgctgggcatggagatctag

DBGET integrated database retrieval system