KEGG   Mesorhizobium loti: mlr5134Help
Entry
mlr5134           CDS       T00043                                 

Definition
xanthine dehydrogenase, xdhA
Orthology
K13481  
xanthine dehydrogenase small subunit [EC:1.17.1.4]
Organism
mlo  Mesorhizobium loti
Pathway
Purine metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mlo00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    mlr5134
Enzymes [BR:mlo01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.1  With NAD+ or NADP+ as acceptor
    1.17.1.4  xanthine dehydrogenase
     mlr5134
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
4070886..4072367
Genome map
AA seq 493 aa AA seqDB search
MAKVNIRNEIRFILNGRDVVLSSVAPDATLLDWLRLDRSLRGTKEGCAEGDCGACTVLVG
RLSAGGLIYESVNACIRFLGSLDGTHVVTVEHLRGQPGQLHPVQQAMVDFHGSQCGFCTP
GFVMSLYGLWMKSPDPSNAAIEKALQGNLCRCTGYEAIMRAAHAISSYGKAAKDPLAVER
KAITARLEALRDGARVEIGSAKARLIVPANVDDFATVLDQEPGATIVAGSTDVGLWVTKH
MRDISPAVFIGNLDGLCTVSEDKGVISIGAGVTYTEAFSMLAKRIPALGPLFDRIGGEQV
RNMGTIGGNIANGSPIGDTPPPLIALGARLTLRKGQKRRTIPLEAFFIAYGRQDRQPGEF
VEAVHVPVPAKGEKFAVYKITKRRDEDITAALGAFLLTLAKDGTVADVRIAYGGMAATPK
RASFVEKALLGKPWTEETVETAMAQYAGDFTPLTDMRASAEYRALAAKNLLLRFFVETTG
TRAPFQVSRNEAA
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atggccaaggtcaacattcgtaacgagatccggttcatcctcaatggcagggatgtcgtg
ctgtcctcggtggcgccggacgcgaccctgctcgactggctgcggctcgaccgttcgcta
cgcggcaccaaggaaggctgcgccgaaggcgattgcggtgcctgcaccgttctggtcggc
cgactttcggccggcggcctgatctatgaaagcgtcaatgcctgtatccgcttcctcggt
tcgctggacggcacgcatgtcgtgacggtggaacatttgcgtggtcagcccggccagttg
catccggtccagcaggcgatggtcgatttccatggctcgcaatgcggcttctgcacgccg
ggcttcgtcatgtcgctctatggtctgtggatgaagtcgccggatccctcgaacgcggcg
attgaaaaggccttgcaaggcaatctctgccgctgcaccggctatgaggcgatcatgcgc
gccgcgcacgccatctccagctacggcaaggcggcgaaggatcctttggctgtcgagcgc
aaggcgatcacggcgaggctggaagccttgcgggacggtgcgcgggtcgagatcggttcg
gccaaggcgcggctcatcgtgccggccaatgtcgacgatttcgccaccgtcctggaccag
gaacccggcgccaccatcgttgccggctcgaccgatgtcggcttgtgggtgaccaagcac
atgcgcgacatctctccggcggtcttcataggcaatctcgacgggctgtgcaccgtctcc
gaagacaagggcgtcatatcgatcggggccggcgtcacctacaccgaagccttttcgatg
ctcgccaaacgcatcccggcgttggggccgctgtttgaccgcatcggcggcgaacaggtg
cgcaacatgggcaccatcggcggcaacatcgccaacggctcgccgatcggcgacacgccg
ccgcccttgatcgcgctcggcgcgcgcctgacgctgcgcaagggccagaagcggcgcacg
ataccgctggaagccttcttcatcgcctatggcaggcaggaccggcaacccggcgaattc
gtcgaggccgtgcacgtgcccgtgccggccaagggagagaaatttgccgtctacaaaatc
accaagcggcgcgacgaggatatcacggcggccctcggcgccttcttgctgacgctggcc
aaggacggcacggtcgccgatgtgcgcatcgcctatggcggcatggcggcgacgccgaag
cgggcgtcttttgtcgaaaaggcgctgctcggcaagccgtggaccgaagagacggtcgag
acggcgatggcgcaatacgctggggatttcaccccgctcaccgacatgcgggcgtcagcc
gaataccgggctctggcagccaagaatttgttgttgcgtttcttcgtcgaaaccaccggc
accagggcacccttccaggtgtcccgcaacgaggcggcatga

DBGET integrated database retrieval system