KEGG   Mesorhizobium japonicum MAFF 303099: mlr5134Help
Entry
mlr5134           CDS       T00043                                 

Definition
(GenBank) xanthine dehydrogenase; XdhA
  KO
K13481  xanthine dehydrogenase small subunit [EC:1.17.1.4]
Organism
mlo  Mesorhizobium japonicum MAFF 303099
Pathway
mlo00230  Purine metabolism
mlo01100  Metabolic pathways
mlo01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mlo00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    mlr5134
Enzymes [BR:mlo01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.1  With NAD+ or NADP+ as acceptor
    1.17.1.4  xanthine dehydrogenase
     mlr5134
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_5 CO_deh_flav_C Fer2_2 Fer2
Motif
Other DBs
NCBI-ProteinID: BAB51635
RhizoBase: mlr5134
UniProt: Q98CI6
Position
4070886..4072367
Genome map
AA seq 493 aa AA seqDB search
MAKVNIRNEIRFILNGRDVVLSSVAPDATLLDWLRLDRSLRGTKEGCAEGDCGACTVLVG
RLSAGGLIYESVNACIRFLGSLDGTHVVTVEHLRGQPGQLHPVQQAMVDFHGSQCGFCTP
GFVMSLYGLWMKSPDPSNAAIEKALQGNLCRCTGYEAIMRAAHAISSYGKAAKDPLAVER
KAITARLEALRDGARVEIGSAKARLIVPANVDDFATVLDQEPGATIVAGSTDVGLWVTKH
MRDISPAVFIGNLDGLCTVSEDKGVISIGAGVTYTEAFSMLAKRIPALGPLFDRIGGEQV
RNMGTIGGNIANGSPIGDTPPPLIALGARLTLRKGQKRRTIPLEAFFIAYGRQDRQPGEF
VEAVHVPVPAKGEKFAVYKITKRRDEDITAALGAFLLTLAKDGTVADVRIAYGGMAATPK
RASFVEKALLGKPWTEETVETAMAQYAGDFTPLTDMRASAEYRALAAKNLLLRFFVETTG
TRAPFQVSRNEAA
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atggccaaggtcaacattcgtaacgagatccggttcatcctcaatggcagggatgtcgtg
ctgtcctcggtggcgccggacgcgaccctgctcgactggctgcggctcgaccgttcgcta
cgcggcaccaaggaaggctgcgccgaaggcgattgcggtgcctgcaccgttctggtcggc
cgactttcggccggcggcctgatctatgaaagcgtcaatgcctgtatccgcttcctcggt
tcgctggacggcacgcatgtcgtgacggtggaacatttgcgtggtcagcccggccagttg
catccggtccagcaggcgatggtcgatttccatggctcgcaatgcggcttctgcacgccg
ggcttcgtcatgtcgctctatggtctgtggatgaagtcgccggatccctcgaacgcggcg
attgaaaaggccttgcaaggcaatctctgccgctgcaccggctatgaggcgatcatgcgc
gccgcgcacgccatctccagctacggcaaggcggcgaaggatcctttggctgtcgagcgc
aaggcgatcacggcgaggctggaagccttgcgggacggtgcgcgggtcgagatcggttcg
gccaaggcgcggctcatcgtgccggccaatgtcgacgatttcgccaccgtcctggaccag
gaacccggcgccaccatcgttgccggctcgaccgatgtcggcttgtgggtgaccaagcac
atgcgcgacatctctccggcggtcttcataggcaatctcgacgggctgtgcaccgtctcc
gaagacaagggcgtcatatcgatcggggccggcgtcacctacaccgaagccttttcgatg
ctcgccaaacgcatcccggcgttggggccgctgtttgaccgcatcggcggcgaacaggtg
cgcaacatgggcaccatcggcggcaacatcgccaacggctcgccgatcggcgacacgccg
ccgcccttgatcgcgctcggcgcgcgcctgacgctgcgcaagggccagaagcggcgcacg
ataccgctggaagccttcttcatcgcctatggcaggcaggaccggcaacccggcgaattc
gtcgaggccgtgcacgtgcccgtgccggccaagggagagaaatttgccgtctacaaaatc
accaagcggcgcgacgaggatatcacggcggccctcggcgccttcttgctgacgctggcc
aaggacggcacggtcgccgatgtgcgcatcgcctatggcggcatggcggcgacgccgaag
cgggcgtcttttgtcgaaaaggcgctgctcggcaagccgtggaccgaagagacggtcgag
acggcgatggcgcaatacgctggggatttcaccccgctcaccgacatgcgggcgtcagcc
gaataccgggctctggcagccaagaatttgttgttgcgtttcttcgtcgaaaccaccggc
accagggcacccttccaggtgtcccgcaacgaggcggcatga

DBGET integrated database retrieval system