KEGG   Mesorhizobium loti: mlr5275Help
Entry
mlr5275           CDS       T00043                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
mlo  Mesorhizobium loti
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:mlo00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    mlr5275
   00052 Galactose metabolism
    mlr5275
   00500 Starch and sucrose metabolism
    mlr5275
   00520 Amino sugar and nucleotide sugar metabolism
    mlr5275
Enzymes [BR:mlo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     mlr5275
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
4205937..4206833
Genome map
AA seq 298 aa AA seqDB search
MKKIRKAVIPVAGLGTRFLPATKSMPKEMLPVVDRPVVQYAVDEAFEAGIEHIVFVTGRN
KAVIEDYFDLHPELIGTLEQTGKKTQLEALESMLPVAGATSFIRQQSPQGLGHAVWCARE
VIGNEPFALLLPDMVSFGGRGCLAETVDLYERTGGNVIAVERCDPSETNKYGIVGRGADI
GGGFEVTAMVEKPAPANAPSNFYINGRYILQPEIFALLGNQQRGAGNEIQLTDAMVRLSK
DQPFFAQPFLGRMFDCGSKEGFIQANIAFALARNDMKGPVFEMLQEFVRSHERQEEAA
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaaatcaggaaggccgtgataccggtggcggggcttggaacacggttcctgccg
gcgaccaagtcgatgccgaaggaaatgctcccggtggtcgacaggcccgtcgtgcaatat
gcggtggacgaggccttcgaagccggcatcgagcacatcgtgttcgtgaccggccgcaac
aaggcggtcatcgaggactatttcgacctgcatccggaattgatcggaaccttggagcag
accggcaagaagacccagctggaggcgctcgaaagcatgctgccggtggccggcgccacc
tccttcatccgccagcaatccccgcagggcctcggccacgccgtctggtgcgcccgcgag
gtcatcggcaacgaacccttcgctttgcttttgccagacatggtctccttcggcgggcgc
ggctgtctggccgaaaccgtcgacctctatgagcgcaccggcggcaacgtcatcgccgtc
gagcgttgtgatccgagcgagaccaacaaatacggcattgtcggccgcggcgccgacatt
ggcggcggtttcgaggtcacggccatggtcgaaaagccggccccggccaacgcgccgtca
aatttctacatcaacggccgctacatcctgcagcctgagatcttcgcgctgctgggcaac
cagcagcgtggcgccggcaacgagatccagctgacggacgccatggttcgcctgtcgaag
gaccagccgttctttgcccagcctttcctgggccgcatgttcgactgcggatccaaggaa
ggcttcatccaggccaacatcgccttcgcgctggcgcgcaacgacatgaagggcccggtt
ttcgagatgcttcaggagttcgtccggtcgcatgaacgtcaggaagaagccgcataa

DBGET integrated database retrieval system