KEGG   Mesorhizobium loti: mlr5510Help
Entry
mlr5510           CDS       T00043                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
mlo  Mesorhizobium loti
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:mlo03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
4418322..4418927
Genome map
AA seq 201 aa AA seqDB search
MSKRIAGPEIERLIQLLAKVPGLGPRSARRAALHLIKKKEQLLSPLAAAMSEAADKVRIC
STCGNVDTADPCMICTDPRRDAGTIIVVEDVSDLWALERAAAMNVRYHVLGGTLSPLDGI
GPDQLNIRSLIDRVAGGEVKEIILAVNATVEGQTTAHYLTDQLSGFDIKVTRLAHGVPVG
GELDYLDEGTLAAALRSRTAF
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgtccaagcgaatcgccggtcccgagatcgaacgcctgatccagctcctggccaaggtg
cctggcctcggtccccgttcggccaggcgcgccgcattgcatctgatcaagaagaaggaa
cagctgctgtcgccgctcgctgctgccatgagcgaggcggccgacaaggtgcgcatctgt
tccacttgcggcaatgtcgatacggcggacccttgcatgatctgcaccgatccgcgccgt
gatgctggcaccatcatcgtcgtcgaggacgtctccgacctgtgggcgctggagcgggcg
gcagcgatgaatgtgcgctaccacgtgctcggcggcacgctgtcgccgctcgatggcatc
ggccccgaccagctcaacatccgctcgctgatcgaccgcgtcgccggcggcgaggtcaag
gagatcatcctggccgtcaatgccacggtcgagggccagaccaccgcgcattacctcacc
gaccagctgtccggcttcgacatcaaggtgacaaggctggcgcatggcgtgccggtcggc
ggcgaactcgactatctcgacgagggcacgctcgccgccgcgctacgctcgcgaacggcg
ttttga

DBGET integrated database retrieval system