KEGG   Mesorhizobium loti MAFF303099: mlr5628Help
Entry
mlr5628           CDS       T00043                                 

Definition
(GenBank) probable acyl-CoA thiolase
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
mlo  Mesorhizobium loti MAFF303099
Pathway
Fatty acid degradation
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:mlo00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    mlr5628
   00630 Glyoxylate and dicarboxylate metabolism
    mlr5628
   00640 Propanoate metabolism
    mlr5628
   00650 Butanoate metabolism
    mlr5628
  Lipid metabolism
   00071 Fatty acid degradation
    mlr5628
   00072 Synthesis and degradation of ketone bodies
    mlr5628
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    mlr5628
   00310 Lysine degradation
    mlr5628
   00380 Tryptophan metabolism
    mlr5628
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    mlr5628
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    mlr5628
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    mlr5628
Enzymes [BR:mlo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     mlr5628
Exosome [BR:mlo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   mlr5628
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
RhizoBase: 
UniProt: 
Position
4520271..4521479
Genome map
AA seq 402 aa AA seqDB search
MAEAYVYDAVRTPRGKGKKDGSLHEVPAVRLAAKTLEALRDRNGLDTGTVDDIIFGCVDP
VGEAGSVIPRAAAFEAGYDTKAPGMQISRFCASGLDAINFGAAKIAQGADEIVIAGGVES
MSRVGMGASGGAWFMDPSVGLPGWFVPQGISADLIATKYGFSRDDVDAYAVESQKRAAKS
WADGRFKNSVIPIKDQNGLTILDHDEHMRPSTDMQSLASLNPSFVMPGEMGGFDAVAVQK
HPEVEEVNHVHHAGNSSGIVDGAAAVLLGSKKAGKAMGLKPRARIRTFANIGSEPVLMLT
GPVDVTEKLLKRAKMKLSDIDLFELNEAFASVVLRYMQAFDIPHDKINVNGGAIAMGHPL
GATGAMIFGTVLDELERRDLNTALVTLCIGAGMGTATIIERV
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atggccgaagcttatgtctatgacgccgtgcgcacgccgcgcggcaagggcaagaaggac
ggatcgctgcacgaagtgccggcggtgcggctcgccgccaagacgctggaagcgctgcgc
gaccgcaatgggctggacacaggtaccgtcgacgacatcatcttcggctgcgtcgatccg
gtcggcgaggcaggttcggtcattccgcgcgccgccgctttcgaggcaggctatgacacc
aaggcgcccggcatgcagatctcgcgcttctgcgcctcgggtctcgacgccatcaatttc
ggcgccgccaagatcgcgcagggcgccgacgagatcgtcattgccggtggcgtcgaatcc
atgtcgcgcgtcggcatgggcgcctccggcggcgcctggttcatggatccttcggttggc
ctgcccggctggttcgtgccgcaaggcatctcggccgacctgatcgccaccaaatacggt
ttctcccgtgatgacgtcgacgcttatgcggtcgagagccagaagcgcgccgccaaatcc
tgggccgacggccgcttcaagaattcggtcattccgatcaaggaccagaacggcctgacc
attctggaccatgacgagcacatgcggccttcgaccgacatgcagtctctggcttcgctc
aacccgtccttcgtcatgcccggcgaaatgggcggcttcgatgcggtcgcggtgcagaag
catccggaggtggaagaggtcaaccacgtccaccacgccggcaactcgtccggcatcgtc
gacggcgcggcggccgtgctgctcggctcgaagaaggcggggaaagccatggggctgaag
ccccgcgcgcgcatccgcaccttcgccaatatcggctccgagccggtgctgatgctgact
ggcccggtcgacgtcaccgagaagctgttgaagcgcgccaagatgaagctttcggacatc
gacctgttcgagctcaacgaggccttcgcctcggtggtgctgcgctacatgcaggccttc
gacatcccgcacgacaagatcaacgtcaatggcggcgccatcgccatgggccatccgctc
ggcgccacaggcgcgatgattttcggcacggtgctggacgaactcgagcgccgcgatctg
aacaccgcgctggtcacgctgtgcatcggcgccggcatgggcaccgcaacgatcatcgaa
cgcgtctga

DBGET integrated database retrieval system