KEGG   Mesorhizobium japonicum MAFF 303099: mlr5629Help
Entry
mlr5629           CDS       T00043                                 

Definition
(GenBank) probable 3-hydroxyacyl-CoA dehydrogenase
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
mlo  Mesorhizobium japonicum MAFF 303099
Pathway
mlo00071  Fatty acid degradation
mlo00280  Valine, leucine and isoleucine degradation
mlo00281  Geraniol degradation
mlo00310  Lysine degradation
mlo00362  Benzoate degradation
mlo00380  Tryptophan metabolism
mlo00410  beta-Alanine metabolism
mlo00640  Propanoate metabolism
mlo00650  Butanoate metabolism
mlo00903  Limonene and pinene degradation
mlo00930  Caprolactam degradation
mlo01040  Biosynthesis of unsaturated fatty acids
mlo01100  Metabolic pathways
mlo01110  Biosynthesis of secondary metabolites
mlo01120  Microbial metabolism in diverse environments
mlo01130  Biosynthesis of antibiotics
mlo01200  Carbon metabolism
mlo01212  Fatty acid metabolism
Module
mlo_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mlo00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    mlr5629
   00650 Butanoate metabolism
    mlr5629
  Lipid metabolism
   00071 Fatty acid degradation
    mlr5629
   01040 Biosynthesis of unsaturated fatty acids
    mlr5629
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    mlr5629
   00310 Lysine degradation
    mlr5629
   00380 Tryptophan metabolism
    mlr5629
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    mlr5629
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    mlr5629
   00281 Geraniol degradation
    mlr5629
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    mlr5629
   00930 Caprolactam degradation
    mlr5629
Enzymes [BR:mlo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     mlr5629
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     mlr5629
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     mlr5629
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 NAD_binding_2 DAO F420_oxidored ApbA UDPG_MGDP_dh_N 2-Hacid_dh_C NAD_binding_8 Sacchrp_dh_NADP NAD_Gly3P_dh_N FAD_binding_3
Motif
Other DBs
NCBI-ProteinID: BAB52040
RhizoBase: mlr5629
UniProt: Q98BD2
Position
4521493..4523712
Genome map
AA seq 739 aa AA seqDB search
MSYINFTLDTDADGIALVTWNMPDRSMNVFTEEVMGELDKIIDQVVADAGIKGAVITSGK
DSFSGGADLTMLQKMLAVFAREKTKDPEKAAKLLFDNAGRMGGLWRKLETSGKPWVSAIN
GTCMGGAFELSLACHGRVAADSDKVKMALPEVKVGIFPGAGGTQRVPRLTDQQQALQMLT
SGQNLSPQKAKAMGLIHEIAEPAKLVETAKAMIRNGLKAVQPWDEKGFKLPGGQIYSPAG
FNLWPPAIAILRRETYGNYPAAAAILKCVYEGLLVPFDTALRIEQRYFTEIMQTKEAAAM
IRSLFVSLQELNKGARRPAGVPETKFKKIGILGAGFMGAGIAYVTAKAGIPVVLLDRDME
SAEKGKAHSDSLVSDQVKKGRAKPEEKDQLLSLITPTADYADLAGCDLVVEAVFEDSAVK
KAATEQAEAVLKSSAIFASNTSTIPITALAKNSARPKNFVGIHFFSPVDKMMLVEIILGK
KTGDKALATAIDFVRAIRKTPIVVNDTRGFYVNRCVLRYMSEAYKMLIEGVPAPMIENAA
KAAGMPVGPLALTDETAIDLAQKIMKQTIRDLGDKAVDPEQMALINTMVDDHGRFGRKNG
KGFYDYPAKPAKKKLWPGLKDLYPQLAAEKVDYEELQQRLLVTIALEAARVMEEGIVIDP
READVGSILAFGFAPYTGGALSYIDGIGAKEFVKIAKGLQKKYGVEFKAPKLLLDMAEKG
ETFYQRFDPYAKGDVKQAA
NT seq 2220 nt NT seq  +upstreamnt  +downstreamnt
atgagctacatcaatttcaccctcgacaccgacgccgacggcattgcgctcgtcacatgg
aacatgccggatcgctcgatgaacgtgttcaccgaggaggtgatgggcgaactcgacaag
atcatcgaccaggtggtggccgacgccggcatcaagggtgcggtgattacctcgggcaag
gacagcttctccggcggcgctgatctcaccatgctgcagaagatgcttgctgtgttcgcc
agggaaaagaccaaggatccggagaaggcggcaaagctgctgttcgacaatgccggccgc
atgggcggtctgtggcgtaagctcgaaacatcaggcaagccctgggtatcggcgatcaac
ggcacctgcatgggcggcgctttcgaattgtcgctggcctgccacggacgcgtcgccgct
gattcagacaaggtcaagatggccttgccggaagtcaaggtcggcatcttccccggcgct
ggcggcacccagcgcgtgccgcgcctgaccgatcagcagcaggcgctgcagatgctgacc
tccggccagaatctgtcgccgcagaaggcgaaggccatgggcctgatccacgagattgcc
gagccggccaagctggtcgagacggcaaaggccatgatcaggaacggactgaaagccgtc
cagccctgggacgagaagggcttcaaattgcccggcggtcagatctattcgccggccggc
ttcaatctctggccgccggccatcgccatcctgcgtcgcgagacctatggcaactatccg
gccgccgccgcgatcctgaaatgcgtctatgaaggcctgctggtgccgttcgacaccgca
ctcaggatcgaacagcgctatttcaccgagatcatgcagaccaaggaagcggcggcgatg
atccgctcgctgttcgtctcgctgcaggaactgaacaagggcgcccgccgcccggccggc
gtgccggaaaccaaattcaagaagatcggcattctcggcgccggcttcatgggcgccggt
atcgcctatgtgacggccaaggccggcattccggtggtgctgctcgaccgcgacatggag
tcggccgaaaagggcaaggcgcattcggacagcctcgtctcggatcaggtcaagaagggc
cgcgccaagccggaggagaaggaccagcttttgtcgctgatcacaccgacggccgattac
gccgaccttgcgggctgcgacctcgtggtcgaagcggtgttcgaggactcagccgtcaag
aaggccgccaccgaacaggcggaggccgtgctgaagtcgtcggcgatcttcgcgtcgaac
acctcgaccattccgatcaccgcgctggcgaagaattcggcgcggccgaagaatttcgtc
ggcatccacttcttctcgccggtcgacaagatgatgctggtcgagatcatcctcggcaag
aagaccggcgacaaggcgctggccaccgcgatcgactttgtccgcgccatcaggaagacg
ccgatcgtcgtcaacgacacgcgcggcttctacgtcaaccgctgcgtgctgcgctacatg
tcggaagcctacaagatgctgatcgagggcgtgcccgcgccgatgatcgagaatgcggcg
aaggccgccggcatgccggttggtccgctggcgctgaccgacgagacggccatcgacctt
gcccagaagatcatgaagcagaccatccgggatctcggcgacaaggccgtcgaccccgag
cagatggcgctgatcaacacaatggtcgacgatcatggccgcttcggccgcaagaacggc
aagggtttctacgattatccggccaagcccgccaagaagaagctgtggccgggattgaag
gacctctatccgcagcttgcggccgagaaggtcgactatgaggagttgcagcagcggctg
ctggtcaccatcgcgctggaagcggcgcgcgtgatggaggagggcatcgtcatcgatccg
cgcgaggccgatgtcggctcgatcctggccttcggcttcgcgccctacactggcggcgcg
ctgtcctatatcgacggcatcggcgccaaggaattcgtcaagatcgccaagggactgcag
aagaaatacggcgtcgagttcaaggcgcccaagctgctactcgacatggccgaaaagggc
gaaaccttctaccagcgcttcgacccctacgccaagggcgacgtgaaacaggccgcctga

DBGET integrated database retrieval system