KEGG   Mesorhizobium loti: mlr5805Help
Entry
mlr5805           CDS       T00043                                 

Definition
cytochrome C peroxidase
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
mlo  Mesorhizobium loti
Brite
Enzymes [BR:mlo01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     mlr5805
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
4682517..4683602
Genome map
AA seq 361 aa AA seqDB search
MASVQNAGRSLVKILFTTVAVALPAIAFAAQTIPVYLRETARATFKPLPSITPTVANNPI
TPEKIALGKAMFFDPRVSASGVLSCNSCHNLATGGDDNQESSIGHGWQKGPRNAPTVLNA
VFNIAQFWDGRAEDLKVQAKAPIQAVVEMANTPGQLIATLKSMPQYVEWFNSAFPGEADR
VTFENVAKAIEAFEATLVTPAPFDAFLNGDDAAMTSEQKQGLTLFMDKGCSSCHGGINVG
GEGYSPFGLVEKPNTDVLPENDKGRFAVTHEADDSYVFRVAPLRNVALTAPYFHSGKVWD
LKQAVAIMGTTQLGQELTEKEVDLLVAFLNSLTGKVPEVAYPVLPAETPTTPRPVLHILP
Q
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atggcttccgtgcaaaacgcagggagatcacttgtgaaaatcctattcactacggtggct
gtcgcgttgccggccatcgcttttgctgcgcaaacgatccccgtatacctcagagaaaca
gcacgggccaccttcaagcctctaccatccatcacgccgacagtcgccaacaacccgatc
acaccggagaagatagccctaggcaaggcaatgttcttcgatccacgcgtctcggcgtca
ggcgtcttgtcgtgcaattcgtgccacaacttggccaccgggggcgacgacaatcaagaa
agctcgatcggccatggttggcagaagggaccgcgcaacgcgccgacggtactgaacgct
gtcttcaacatagcgcagttctgggatggtcgtgctgaagacctgaaggttcaggccaag
gcaccgatccaagccgttgtcgaaatggccaacacaccaggtcaactcatcgccacgctc
aagtcgatgccgcaatatgtcgagtggttcaattcagctttcccgggcgaagccgatcgc
gtcaccttcgaaaacgtcgccaaggcaatcgaagcctttgaggcgacactggtcacaccg
gcgcccttcgatgccttcctcaacggcgatgacgccgctatgacttccgaacagaaacag
ggcctgacgcttttcatggacaaaggctgctcgtcctgccacggcggtatcaacgtgggt
ggggagggctattccccattcggcctcgttgaaaagcccaacaccgatgtcctgccggaa
aacgacaaaggccgatttgccgtgacccatgaagccgacgattcctatgttttccgcgtg
gcgccgttgcgcaacgtagcactcaccgcgccatactttcattcgggcaaggtttgggat
ctgaaacaggccgtcgccattatggggaccacccagctcggccaagaattgacggaaaaa
gaagtcgacctgctcgttgccttccttaattcgctgaccggaaaagtaccggaggtcgcc
tatcccgtcttacccgccgaaacgccgacaacgcctcgacctgtattgcatatcctcccg
caatga

DBGET integrated database retrieval system