KEGG   Mesorhizobium loti: mlr5888Help
Entry
mlr5888           CDS       T00043                                 

Definition
asparagine synthetase
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
mlo  Mesorhizobium loti
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mlo00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    mlr5888
Enzymes [BR:mlo01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     mlr5888
Peptidases [BR:mlo01002]
 Cysteine Peptidases
  Family C44
   mlr5888
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
4756027..4757919
Genome map
AA seq 630 aa AA seqDB search
MCGIFGIVLKNEGTPVCAAAVERCADALAHRGPDASGLYINQSVAFAHRRLSIVDAHSRA
NQPYRDANTGVVVTYNGEIFNYREIRTELRDMGFFFSTVSDTEVLILSYIAWGKSFLNRL
DGIFAFALFDPRNSLVLIARDRLGVKPLYYTICDVGLLFASQPNALIRWPGVMRGPDMIG
ALSFLSYRAVVGARTLFAGISKLEPGHLLEIRNGRHTSERWWNLSERISRCKPDYSDIRR
LLGSAVERQLVADVPVAALLSGGLDSSILAYEASARSQIRPICYTGKVETADYDETAYAM
EVAAEFGLTHRVVPIGEPSDIYAVSELVRLRGHPLGMHNEIAMFTLAKAISKEHKVVLTG
EGADEIFAGYSRLFRTPYDYNRSKIIAALPRALAQVARRRLGLDVHGSQLQFFLARYSYF
PTDEIRSLVIDGRVRREHEMALFDHFSTQFAEAGGDFFSKISYVLVSTHLPALLEMVDNT
TMAAGLEARVPYTDHQLVTAAMAMPGSQRLRWRSPIASVQALWHPVASFSERLDVSKFPL
RREYRSVLPRSVLSRKKMGFPLPLGQWAVGEGATEYRRLLFDKDSPLGDLFDPAALRRWF
EAGRRNPSDSFGRKFWLLANLGIFFKEVFS
NT seq 1893 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggaatctttgggatagtcctcaaaaacgagggaacacccgtttgtgctgcggcc
gttgagcgttgcgctgacgctctcgctcatcgcggacctgatgccagcggcctatacatt
aatcaatcggtagcattcgcgcatcgacggctatcgattgtcgacgctcattctcgagcc
aatcagccctatcgcgatgccaataccggagtggtggtaacgtacaacggcgagatattc
aactatcgggaaattagaactgaattgagggatatgggttttttcttctcgacggtgtcc
gacaccgaggttctaattcttagctatattgcttggggaaagtcattcttaaatcgtctt
gacgggatatttgccttcgcgcttttcgacccgcggaactcgcttgttctcatcgcccga
gatcgtttgggggtaaaacccctttactacacgatctgcgacgttgggcttctgtttgcg
tcgcagccgaacgctctcattcgctggccgggcgtcatgcgcggacccgacatgatcggc
gcgctcagctttctatcctatcgcgcggttgtcggcgccagaacgctgttcgccgggatt
tccaagttagagcccggccatctcctcgaaataagaaatgggcgacacacgtccgaacgt
tggtggaatctgtcagagcgcatttcgcgatgtaagcccgactactccgacatacgcaga
ctactcggaagcgccgtcgaacgtcagctggtggctgacgtaccggtcgccgcattgttg
tccggtggacttgactcgagcatcctcgcctatgaggcgtccgcccgctcccaaatccgt
ccgatctgctataccggcaaggtcgagaccgccgattatgacgagacggcttatgcgatg
gaggtcgccgcagaattcgggctcactcaccgggtcgtcccaattggagaaccttccgat
atctacgctgtgtcagagctggttcgcctgcgcggacatccgcttgggatgcataacgaa
atcgcaatgtttacgctcgcaaaggcgatttcgaaggagcataaggtcgtcctcaccggc
gagggggccgatgagatttttgctggctacagccgattgttccgtacgccgtatgattac
aatcgaagcaagatcatcgccgcattaccacgtgctcttgcccaggtcgcacgccggcgc
ctcggactcgacgtccatggcagtcaattgcagttcttcctggcgcgttacagctacttc
ccgaccgatgaaatccgctcgcttgtcatcgatgggcgggtacgaagggagcacgagatg
gctctgttcgatcacttctcgactcaatttgcagaggccggcggagatttctttagcaag
atctcatatgttctcgtctctacgcatttgcccgcattgctggaaatggttgacaacacc
acaatggcagctgggcttgaagctcgcgttccttataccgatcaccagctcgttaccgcc
gcaatggcgatgcccggctcacagcggttgaggtggaggtctccaatcgcttcggtccag
gcactgtggcatccggttgcttccttcagcgaacgtctcgatgtctcaaaattcccctta
agaagggaataccggagcgtcttgcccagatctgttctatctcgcaaaaagatgggattt
ccgctgccactgggtcagtgggccgttggcgagggagcaacggaatatcgaaggctgctg
tttgataaggactctccactgggagatttgttcgatcctgctgctttgcggcgttggttc
gaggccggacgacgaaatccttcagactcgtttggtcggaagttctggctgttggccaac
cttgggatattcttcaaagaggtattctcatga

DBGET integrated database retrieval system