KEGG   Mesorhizobium loti: mlr6298Help
Entry
mlr6298           CDS       T00043                                 

Definition
gamma-glutamyl kinase (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
mlo  Mesorhizobium loti
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:mlo00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    mlr6298
  Amino acid metabolism
   00330 Arginine and proline metabolism
    mlr6298
Enzymes [BR:mlo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     mlr6298
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
5114952..5115806
Genome map
AA seq 284 aa AA seqDB search
MQEKIRETCLATKTVKLLSARRLIVKIGSAVVADAETGEIRGPWLETLIKDVVRFFARGQ
QVIIVTSGAVAAGSRHFKQLDRSLRIEEKQAAAAIGQIRLMIAYEQSLKRHGFGLGQVLL
TSADVDNQRCRLNARSAFQQLLNVGAVPVINENDATATPEVCLGDNDRLAARVAQIAKAD
LLILLSDVDGLFTEDPHDNPLARMIPEVRRITPEIEIMASLSPARHGSGGMVTKLMAARI
AMEAGCNVVIAKGSKSYPLAAIENGAPSTWFIPPARETATRGGR
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atgcaagaaaagattagagagacatgtcttgcaacgaagacggtcaaattgctttcggct
cgccgactgatcgtgaagattggctccgcagtggttgccgatgcggagaccggagagata
cgcggtccttggcttgaaacgttgataaaggatgtcgtccgatttttcgcgcgcggccag
caggtgatcatagtcacctccggtgctgtcgcggctggatcacgtcacttcaagcagttg
gacagatctttgcgaattgaggagaagcaagcggccgccgcgattggtcagatccgactg
atgatcgcttatgaacagagcttgaaacgccatgggtttggcctggggcaggtgctattg
accagcgcagatgtagacaaccagcgttgccgcctcaatgcgcggtcagcctttcaacaa
ctcctcaacgttggcgctgtacccgttatcaacgagaacgacgcgaccgcaacgcccgag
gtctgtcttggcgacaatgatcggctggcggcaagggtcgcgcaaattgcaaaggccgac
cttctcattctgctttccgacgtagatggcctctttacggaagatccacacgacaacccg
ttggctcgtatgatcccagaggtgcggcgcattaccccggagatagaaatcatggccagc
ctttcccccgcgcgccatggttcgggcggcatggtgacaaagttgatggcagcaaggata
gcgatggaagcgggctgcaacgtggtcattgcgaaaggaagcaagtcttatccgctcgcc
gccatcgagaacggtgcgccatcaacatggtttattccgcccgccagggagacggcaaca
cgcgggggccgttga

  All links  
No link information was found.   
DBGET integrated database retrieval system