KEGG   Mesorhizobium loti: mlr6443Help
Entry
mlr6443           CDS       T00043                                 

Definition
alpha-galactosidase
Orthology
K07406  
alpha-galactosidase [EC:3.2.1.22]
Organism
mlo  Mesorhizobium loti
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:mlo00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:mlo00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:mlo00600]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
5264485..5265951
Genome map
AA seq 488 aa AA seqDB search
MSFKIAIIGAGSVGFTKKLFTDILCVPEFRDIEFALTDLSEHNLGMIKAILDKVVEANGL
PTRVTATTDRRKALEGARYIISCVRVGGLEAYADDIRIPLKYGIDQCVGDTICAGGILYG
QRNIPVILDFCKDIREVAATGAKFLNYANPMAMNTWAAIEYGKVDTVGLCHGVQHGAEQI
AEVLGAKSRHELDYVCSGINHQTWFIDLRLNGRKIAKDELVEAFEAHPIYSQQEKLRIDV
LKRFGVYSTESNGHLSEYLPWYRKRPDEITRWIDMSDWIHGETGGYLRYSTETRNWFETE
YPQFLEAASKPIDPAKRSNEHASHILEALETNRVYRGHFNVRNDGLITNLPQDAIVESPG
FVDRFGINMAAGITLPEACAATCMSSINVQRMSVHAAISGDIDLLKLAVLHDPLVGAVST
PEEVWQMVDEMVVAQAQWLPQYAHAVPAAKERLSKSAVKTREWAGAARRNVRSIEELRAE
KAALKQAG
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atgagtttcaaaatcgctatcatcggtgccggcagcgtcggattcaccaagaaactgttc
accgacatcctgtgcgtgcccgaattcagggatatcgaattcgcactgaccgacctcagc
gaacacaatctcgggatgatcaaggcgattctcgacaaggtcgtcgaggcgaacgggttg
ccaaccagggtgacggcgacaaccgatcgccgcaaggcgctcgaaggcgcgcgctatatc
atcagttgtgtgcgggtcggcggcctcgaggcctatgccgacgacattcgcattccgctg
aaatatggcatcgaccagtgcgtcggcgacaccatctgcgcaggcggcatcctctatggc
cagcgcaacattcccgtgatcctcgacttctgcaaggacatacgcgaggtcgccgcgacg
ggcgccaaattcctcaactatgccaacccgatggccatgaacacttgggcggcgatcgaa
tacggcaaggtagacacggtcggcctctgccacggcgtccagcatggcgccgagcagatc
gccgaggtgctgggagcgaagtccaggcacgagctcgactatgtctgttccggcatcaat
caccagacctggttcatcgatttgcggctgaatggccgcaagatcgccaaggacgaactg
gtcgaagcgttcgaggcgcatccgatctattcgcagcaggaaaagctgcgcatcgatgtc
ttgaagcgcttcggtgtctattcgaccgagagcaacggccatctctccgaatatctgccc
tggtaccgcaagcggcccgacgagatcacccgctggatcgatatgtcggactggatccat
ggcgagaccggcggctatctccgctactccaccgaaacccgcaactggttcgagacggag
tatccgcaattcctcgaagcggcgtcgaagccgatcgatccggccaagcgctccaacgaa
cacgccagccacatattggaggcgctggagaccaatcgggtctatcgtggccacttcaac
gtcaggaatgatggcctgatcaccaatctgccgcaggatgccatcgtcgagtcgcccggc
ttcgtcgaccgtttcggcatcaacatggccgccggcatcacattgccggaagcctgtgcg
gccacctgcatgtcttcgatcaacgtccagcgcatgtcggtgcatgccgcgatatcaggc
gacatcgatctcctgaagctcgccgtgctgcacgacccgctggtcggcgcggtgtcgacg
ccggaggaagtctggcagatggtggacgaaatggtcgtcgcccaggctcaatggctgccg
caatatgcgcatgcggttccggccgccaaggagcggctgtcgaaatccgcggtcaagacc
cgcgaatgggcgggtgctgcgcggcgaaacgtgcgctcgatcgaggaattgcgcgccgaa
aaggccgcgctcaaacaggccggctga

DBGET integrated database retrieval system