KEGG   Mesorhizobium loti: mlr6575Help
Entry
mlr6575           CDS       T00043                                 

Definition
phosphoketolase
Orthology
K01621  
phosphoketolase [EC:4.1.2.9]
Organism
mlo  Mesorhizobium loti
Pathway
Pentose phosphate pathway
Carbon fixation in photosynthetic organisms
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mlo00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    mlr6575
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    mlr6575
Enzymes [BR:mlo01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.9  phosphoketolase
     mlr6575
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
5384229..5386652
Genome map
AA seq 807 aa AA seqDB search
MNDHTTIAASGGRLSDRELHDLDAYWRAANYLTIGQIYLLDNPLLREPLRLEHVKPRLLG
HWGTSPGLSFIYAHLNRAIRLRDANVIYICGPGHGGPAMVANTYLEGTYSELNPDIAMDE
QGMRKLFRQFSFPGGIPSHAAPDVPGSIHEGGELGYSLSHAYGAAFDNPDLVVACVVGDG
EAETGPLAAAWHSNKFLNPARDGAVLPILHLNGYKIANPTILARIPEDELRALFAGYGYE
PLFVAGHEPALMHQRMATVLDDAFDRISAIKHAARNGSGATGSRPEWPMIVLRSPKGWTG
PKEVDGLKTEGFWRSHQVPLSGLAENPAHLKLLEEWLKSYRPEELFDAAGAPVASIRATA
PQATKRMSANPHANGGLLRRSLELPGLHDHAVSLERPGAVKAESTRVMGSFLRDVMRLNE
VAKNFRIVGPDETASNRLQDVFEVTERGWMEKILPEDVHLGREGRVLEILSEHTCQGWLE
GYLLTGRHGLFSCYEAFIHIVDSMFNQHAKWLDACREIPWRRPIASLNYLLSSHVWHQEH
NGFSHQDPGFIDVALNKKADIVRVYLPPDANTLLCVTDHVLQTWNRINVIVAGKPPSWQW
LSMDKAIVHCRAGIGVWDWASTDDGAEPDVVMACAGDVPTLETLAAVQILRQQVPDLRIR
VVNVVDLMTLQPKEYHPHGLSDREFDALFTPDKPVIFAYHGYPWTIHRLTYRRTNHDNIH
VRGYNEEGTTTTPFDMTVLNGLDRFHIVQSVLDWVPRLKGVRVSLKQAMDSKLLEHRAYI
CSHGQDMPEILDWKWGQDPDAAPKRPD
NT seq 2424 nt NT seq  +upstreamnt  +downstreamnt
atgaacgatcatacgacaatagcagcttccggtggccggctgtccgatcgcgagttgcac
gatctcgacgcctattggcgcgccgccaactacctgacgattggccagatctacctgctc
gacaatccgctgttgcgcgagccgttgcggctggagcacgtcaagccgcgtctcctcggc
cactggggaacgtcgcccggcttaagcttcatctatgcgcacctcaatcgcgcgatccgg
ctcagggacgcgaatgtgatctatatctgcggcccgggacacggcggtccggcgatggtg
gcaaacacctatctggagggcacctacagcgagctcaatcccgacatcgcgatggacgag
caggggatgcgcaagctgttccggcagttttcgtttcccggcggtatcccgagccatgcg
gcaccagatgtgcccggctcgatccatgagggtggtgagttgggctattcgctgtcgcac
gcctatggcgccgcctttgacaatccggatctcgtcgttgcctgcgtcgtcggcgacggt
gaagcagaaaccggaccgctggcagccgcttggcattccaacaaattcctcaacccggcg
cgcgacggagccgtgctgccgatcctgcacctgaacggctataagatcgcaaatccaacc
attctggcccgcattcctgaagacgaattgcgcgcgctgtttgccggctacggctatgag
ccgctgtttgtggcaggccacgagccggccctgatgcatcagcgaatggcgactgtgctc
gatgatgcgttcgatcgcatctcggctatcaagcatgcagcgcgcaatggatctggggcg
actgggtcacgaccagaatggccgatgatcgtgttgcgcagccccaagggttggaccggt
ccgaaagaggtcgacgggctgaagaccgaaggcttctggcgctcgcaccaggttcccttg
tcaggccttgctgaaaaccccgcccatctcaagctgctcgaggagtggctgaaaagctac
cgaccggaggaactgttcgacgccgccggtgctcctgtcgcttcgatccgcgcgacggca
ccccaggcaacgaaacgaatgagtgcaaacccgcacgccaacggcggcctgctgcgcagg
tccctcgaactgccgggcttgcatgaccacgccgtttcactcgagcgccccggtgcagtc
aaggccgagtcgacacgggtcatgggcagcttcctgcgtgatgtcatgcggttgaacgag
gtcgcaaagaacttccgcatcgtcggcccggacgagacggcctcgaaccgtcttcaggac
gtgtttgaagtgaccgagcgtggctggatggaaaagattctgcccgaagacgttcacctc
gggcgcgagggccgggtgctcgaaatcctctccgagcacacctgccagggctggctggaa
ggctacctgctcaccgggcgccacggcctgttttcctgctacgaggcgtttatccacatc
gtcgattccatgttcaaccagcatgcaaaatggctggatgcctgccgcgagatcccgtgg
cgccggccgatcgcatcactgaactatctgttgtccagccatgtctggcatcaggaacat
aacggcttcagccatcaggaccctggtttcatcgacgtcgccctcaacaagaaggccgac
atcgtacgggtctacctgccaccggacgccaacaccttgctgtgcgtgaccgaccatgtg
ctgcagacctggaaccgcatcaacgtcatcgtcgccggcaagccgccgtcatggcagtgg
ctgtcgatggacaaggcgatcgttcactgccgggcagggatcggcgtctgggactgggca
tcaacggacgatggggctgagcccgacgtcgtgatggcttgcgctggtgacgtcccgacc
ctcgaaacgctggccgccgtgcagatcctcaggcagcaggttcctgatctcaggatcagg
gtggtcaacgtcgttgacctgatgacccttcagcccaaggaatatcatccacacggtctt
tcggatcgcgagttcgatgcgctgttcacccccgataaaccggtcatctttgcctatcac
ggctatccctggaccattcaccgcctgacctatcgacgcaccaaccatgacaacatccat
gtgcgcggctacaacgaggaagggacgacgacgacacctttcgatatgacggtgctgaac
ggccttgaccgctttcatatcgtccaaagcgtcctcgactgggttccgcgactgaagggc
gtgcgggtcagcctgaagcaggcgatggacagcaagctgcttgaacatcgggcctatatt
tgctcccatgggcaggatatgccggagattcttgattggaagtggggacaggatcccgat
gcggcgccgaagcgtccggattga

DBGET integrated database retrieval system