KEGG   Mesorhizobium loti MAFF303099: mlr7275Help
Entry
mlr7275           CDS       T00043                                 

Definition
(GenBank) triose-phosphate isomerase
  KO
K21910  
L-erythrulose 1-phosphate isomerase [EC:5.3.1.33]
Organism
mlo  Mesorhizobium loti MAFF303099
Brite
Enzymes [BR:mlo01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.33  L-erythrulose 1-phosphate isomerase
     mlr7275
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
RhizoBase: 
UniProt: 
Position
6013696..6014460
Genome map
AA seq 254 aa AA seqDB search
MRVVYWVGTSWKMNKTLAEALDFAERLAGFIPGFDDRIQPFVIPPFTAVREVKRALSSTR
IKVGAQNMHWADAGAWTGEISPPMLRDCGLDLVELGHSERREHFGETDRTVGLKTAAAVK
HGMIPLICVGETLAERESGQADAVLSAQVEGALQFLEGEAKTAKILFAYEPVWAIGDKGI
PASADYADKQQALIKTVAGALLPSVPPVLYGGSVNPGNAAELVGQPNIDGLFIGRSAWQA
DGYIDILGRASAAI
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
gtgcgcgtggtctactgggtcggtacaagctggaagatgaacaagacgctcgccgaggca
ctggatttcgcggagcgcctggcaggcttcattcccggtttcgatgaccgcatccagccc
ttcgtcatcccacctttcacggcggtgcgcgaggtcaagcgggcgctgtcgtcgacgcgc
atcaaggtcggtgcgcagaacatgcattgggccgatgccggcgcctggaccggcgagatt
tcgccaccgatgctgagggattgcgggctcgatctggtcgaactcggccacagcgaacgg
cgcgagcattttggcgagaccgatcgcaccgtcggcctgaaaacggctgccgccgtgaag
cacgggatgataccgctgatctgtgtcggcgagacgctggccgagcgcgaaagtgggcag
gccgatgccgtgctgagcgcccaggtcgagggcgcgctgcagttcctcgaaggcgaggcg
aagaccgcgaaaatcctgttcgcctacgagccggtctgggcgatcggcgacaagggcatt
ccggccagcgccgactatgccgacaagcagcaggcattgatcaagacagtggccggcgcc
ctgctgccgtcggtgccgccggtgctttatggcggcagcgtcaatcccggcaatgccgcc
gagctggtcggccagcccaatatagacggcctcttcatcggccgttccgcctggcaggcg
gacggctacatcgacattctcggccgcgcctcggcggcgatctga

DBGET integrated database retrieval system