KEGG   Mesorhizobium loti: mlr7275Help
Entry
mlr7275           CDS       T00043                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
mlo  Mesorhizobium loti
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:mlo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    mlr7275 (tpiA)
   01230 Biosynthesis of amino acids
    mlr7275 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    mlr7275 (tpiA)
   00051 Fructose and mannose metabolism
    mlr7275 (tpiA)
   00562 Inositol phosphate metabolism
    mlr7275 (tpiA)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    mlr7275 (tpiA)
Enzymes [BR:mlo01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     mlr7275 (tpiA)
Exosome [BR:mlo04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   mlr7275 (tpiA)
  Exosomal proteins of bladder cancer cells
   mlr7275 (tpiA)
  Exosomal proteins of melanoma cells
   mlr7275 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
6013696..6014460
Genome map
AA seq 254 aa AA seqDB search
MRVVYWVGTSWKMNKTLAEALDFAERLAGFIPGFDDRIQPFVIPPFTAVREVKRALSSTR
IKVGAQNMHWADAGAWTGEISPPMLRDCGLDLVELGHSERREHFGETDRTVGLKTAAAVK
HGMIPLICVGETLAERESGQADAVLSAQVEGALQFLEGEAKTAKILFAYEPVWAIGDKGI
PASADYADKQQALIKTVAGALLPSVPPVLYGGSVNPGNAAELVGQPNIDGLFIGRSAWQA
DGYIDILGRASAAI
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
gtgcgcgtggtctactgggtcggtacaagctggaagatgaacaagacgctcgccgaggca
ctggatttcgcggagcgcctggcaggcttcattcccggtttcgatgaccgcatccagccc
ttcgtcatcccacctttcacggcggtgcgcgaggtcaagcgggcgctgtcgtcgacgcgc
atcaaggtcggtgcgcagaacatgcattgggccgatgccggcgcctggaccggcgagatt
tcgccaccgatgctgagggattgcgggctcgatctggtcgaactcggccacagcgaacgg
cgcgagcattttggcgagaccgatcgcaccgtcggcctgaaaacggctgccgccgtgaag
cacgggatgataccgctgatctgtgtcggcgagacgctggccgagcgcgaaagtgggcag
gccgatgccgtgctgagcgcccaggtcgagggcgcgctgcagttcctcgaaggcgaggcg
aagaccgcgaaaatcctgttcgcctacgagccggtctgggcgatcggcgacaagggcatt
ccggccagcgccgactatgccgacaagcagcaggcattgatcaagacagtggccggcgcc
ctgctgccgtcggtgccgccggtgctttatggcggcagcgtcaatcccggcaatgccgcc
gagctggtcggccagcccaatatagacggcctcttcatcggccgttccgcctggcaggcg
gacggctacatcgacattctcggccgcgcctcggcggcgatctga

DBGET integrated database retrieval system