KEGG   Mesorhizobium loti: mlr7577Help
Entry
mlr7577           CDS       T00043                                 

Definition
pssB protein, exopolysaccharide production
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
mlo  Mesorhizobium loti
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mlo00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    mlr7577
Enzymes [BR:mlo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     mlr7577
Transfer RNA biogenesis [BR:mlo03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    mlr7577
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
6262364..6263215
Genome map
AA seq 283 aa AA seqDB search
MSATLPKTNMKAAAASDDRSMLDILERLALAAGREVMRVFHAGCAVDRKSDASPVTEADR
ESEKIILSGLRAAFPEIPCVAEEEAAAGIMPTDLGEAFFLIDPLDGTKEFVNRRTDFTVN
IALVRHGVPEVGVVFAPCTGRFFSGRPGSAEALEIDDDYQIVGRRPISVRAAASPLAVVA
SRSHNTPETEAYIRDLGAAEIVSVGSSLKFCLLASAEADVYPRFGRTMEWDTAAGDAVLR
AAGGTTRTLDGKPLAYGKRDQADDEDFANPHFIASGRAGAIPA
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcgacattgccgaagaccaatatgaaagcggcggcggcatctgacgacaggtcg
atgctcgacatcttggagcggctggccctggcggccggacgcgaggtgatgcgcgttttc
cacgccggctgcgccgtcgaccggaaatcagacgcctcgccggtgaccgaggcggaccgt
gagagcgagaagatcattctctccggcctgcgcgccgcatttcccgagattccctgcgtg
gccgaagaggaagcggcggctggaatcatgccgaccgatctcggcgaggccttcttcctc
atcgacccgctcgacggcaccaaggaattcgtcaatcgccgtaccgacttcaccgtcaac
atcgcgcttgtccgccatggcgtgccagaagtcggcgtcgtcttcgcgccgtgcaccggc
cgcttcttttcgggacggccgggcagcgcggaagccctggaaatcgatgacgactatcag
atcgtcggccgccggccgatttcggtgagagcggccgcatcaccgctggccgtggttgcc
agccgctcccacaacacaccggaaaccgaagcctatattcgcgacctaggcgccgccgag
atcgtttccgttggctcgtccttgaaattctgtcttctcgccagcgccgaggcggatgtc
tatccgcggttcggccgcaccatggaatgggacaccgcggcgggcgacgcggtgctgcgc
gcggcgggcggcacgacacgtacgctggacggcaagcccttggcctacggcaaacgcgac
caggccgacgacgaggatttcgccaacccgcatttcatcgccagcggcagggcaggggca
atccccgcctga

DBGET integrated database retrieval system