KEGG   Mesorhizobium loti: mlr7587Help
Entry
mlr7587           CDS       T00043                                 

Definition
glycogen branching protein (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
mlo  Mesorhizobium loti
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:mlo00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    mlr7587
Enzymes [BR:mlo01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     mlr7587
Exosome [BR:mlo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   mlr7587
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
6273182..6275395
Genome map
AA seq 737 aa AA seqDB search
MRKPRVTAATSGPDGLAPASDVAAIVAGTHGDPFAVLGVHEVGKGLFARCFVPHAETVTA
YTLTGIEAGALSRRDDAGFFEGKLSIKKRQPLRYHAHNAGGDWWLTDPYSFGPVLGPMDD
YYIAEGSHLRLFDKLGAHVIEHEGATGVHFAVWAPNAKRVSVVGDFNDWDGRRHTMRDRR
DTGIWEVFIPDIGAGRPYKYEIIGPDGVRLPLKADPFAFKSELRPATASVVAVPPAHDWG
DEAHRNYWRNADPRREAVSIYEVHAGSWQLHDDGTFLSWDELADRLIPYVVETGFTHIEF
MPISEHPYDPSWGYQTTGLYAPSARFGDPDGFARFVDGAHRAGVGVILDWVPAHFPVDAH
GLAHFDGTALYEHADPRKGFHPDWNTAIYNFGRREVVSFLVNNALFWAEKYHVDGLRVDA
VASMLYLDYSRKAGEWIPNEKGGRENLEAVSFLQKMNKEVYGHHPGVMTIAEESTSWPKV
SAPVHEGGLGFGFKWNMGFMHDTLEYFSKEPIFRKHHHNDLTFGLTYAFSENFVLPLSHD
EVVHGKGTLLSKMAGDDWQKFATLRAYYGFMWGYPGKKLLFMGQEFAQRREWSEARALDW
NLLDFRPHRGVWQTVRDLNYLYRSRPALHGRDCEPEGFSWLIVDDSQNSVFAWVRNAPGG
SPVAVISNFTPVPRDNYRVPLPKAGKWREIINTDASEYGGSGMGNGGMVEARAEGKNISA
TMLLPPLSTIMLELVAD
NT seq 2214 nt NT seq  +upstreamnt  +downstreamnt
atgaggaagccgcgcgtgaccgctgcgacaagcgggccggacggactggcgccagccagc
gatgttgcggcgattgtcgccggtacgcacggagatccgttcgcggtcctcggtgtccat
gaggtcggcaaaggcctgtttgcccgttgtttcgttccgcatgccgagactgtcactgcc
tatacgctgacgggcatcgaggccggtgcgttgtccaggcgagacgatgctggcttcttc
gaaggcaagctgtcgatcaagaagcggcagccgctgcgctatcacgcgcacaatgccggc
ggcgactggtggctgaccgatccttattcgttcggcccggtgctcgggccgatggacgat
tactatatcgccgaaggttcgcatctcaggctgttcgacaagcttggcgcgcatgtcatc
gagcacgaaggcgccaccggcgtgcatttcgccgtctgggctcccaacgcaaaacgcgtc
tcggtggttggcgatttcaacgactgggatggccgccgccacacgatgcgcgatcgccgc
gacaccggcatctgggaggtgttcatccccgacatcggtgccgggcgaccctacaaatac
gagatcatcggacccgatggcgtcaggctgccgctgaaggccgatccgtttgcgttcaaa
tccgaattgcgtcctgccacggcttcagtggtcgccgtgccgccggcgcatgactggggc
gacgaggcgcatcgcaactactggcgcaatgccgatccccggcgcgaagccgtctcgatc
tacgaagtccatgccgggtcatggcaacttcacgacgacggcacgttcctgtcatgggac
gagctggccgaccggctgatcccctatgtcgtcgagaccggcttcacccacatcgagttc
atgccgatctccgagcatccctatgatccgtcctggggctatcagaccaccggcctctat
gcgccgtcggcccgcttcggcgatcctgacggctttgcccgtttcgttgatggcgcgcac
cgcgccggcgtcggcgtcatcctcgattgggtgccggcgcatttcccggtcgatgcgcac
ggcctggcccatttcgacggcaccgcgctctacgaacatgccgatccgcgcaagggtttt
caccccgactggaacaccgcgatctacaatttcgggcgccgcgaggtggtctcgttcctg
gtcaacaatgcgctgttctgggccgaaaaatatcatgtcgacggtttgcgcgtcgatgcg
gtcgcctcgatgctctacctcgactattcgcgcaaggccggcgagtggatccccaacgag
aagggcggccgcgagaacctcgaggcggtctctttcctgcagaagatgaacaaggaggtc
tacggccaccatccaggcgtcatgaccatcgccgaggaatcgacctcctggccgaaggtt
tcggcgccggtgcacgaaggcgggctgggcttcggcttcaagtggaacatgggcttcatg
catgacacgctggagtatttctccaaggagccgattttccgcaagcaccaccacaacgac
ctgaccttcggcctgacctacgccttctcggagaatttcgtgctgccgctctcgcatgac
gaggtcgtgcacggcaaaggcacgctgctgagcaagatggccggcgacgactggcagaaa
ttcgcaaccttgcgcgcctattacggcttcatgtggggctatcccggcaagaagctcttg
ttcatgggacaggaattcgcgcagcgccgtgaatggagcgaggcgcgtgctcttgactgg
aacctgctcgatttccgcccgcatcgcggcgtctggcagacggtgcgcgatctcaactat
ctctaccgctcgcgcccggcgctgcacggccgcgactgcgagccggaaggattttcctgg
ctgatcgtcgatgacagccagaattcagttttcgcctgggtgcgcaacgcgccgggcggc
agcccggtggccgttatctccaacttcacgccggtgccacgcgacaattatcgcgtgccg
ctgccgaaggctggcaagtggcgcgagatcatcaacaccgacgcatccgaatatggcggc
tccggcatgggcaatggcggcatggtcgaggcaagggcggaaggcaagaacatctctgca
acgatgcttctgccgccgctgtcgacaatcatgctcgaactcgttgccgactga

DBGET integrated database retrieval system