KEGG   Mesorhizobium loti MAFF303099: mlr7614Help
Entry
mlr7614           CDS       T00043                                 

Definition
(GenBank) 3-ketoacyl-CoA thiolase
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
mlo  Mesorhizobium loti MAFF303099
Pathway
Fatty acid degradation
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:mlo00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    mlr7614
   00630 Glyoxylate and dicarboxylate metabolism
    mlr7614
   00640 Propanoate metabolism
    mlr7614
   00650 Butanoate metabolism
    mlr7614
  Lipid metabolism
   00071 Fatty acid degradation
    mlr7614
   00072 Synthesis and degradation of ketone bodies
    mlr7614
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    mlr7614
   00310 Lysine degradation
    mlr7614
   00380 Tryptophan metabolism
    mlr7614
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    mlr7614
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    mlr7614
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    mlr7614
Enzymes [BR:mlo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     mlr7614
Exosome [BR:mlo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   mlr7614
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
RhizoBase: 
UniProt: 
Position
6305261..6306439
Genome map
AA seq 392 aa AA seqDB search
METAMTACIVGWAHSRFGKLEGETLENLIVKVATDALDHAGIGPDEVDEIVLGHFNAGFS
AQDFTASLVLQADDRLRFKPATRVENACATGSAAVRQGIRAIDANAARIVLVVGAEQMTT
TPGPEIGKNLLKASYLPEDGETPAGFAGVFGKIAQAYFQRYGDQSDALAMIAAKNHKNGV
DNPYAQMRKDFGYDFCRQESEKNPFVAGPLKRTDCSLVSDGAAALILADTATALKMRRAV
AFRANEHVQDFLPMSKRDILAFEGCEQAWTRALKNAGVTLDDLSFVETHDCFTIAELIEY
EAMGLARPGEGAKLALDGTTAKDGRLPVNPSGGLKAKGHPIGATGVSMHVLTAMQLVGEA
GGIQVPGAKLGGIFNMGGAAVANYVSILDRIR
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atggagaccgccatgaccgcatgcatcgttggctgggcgcattcgcgcttcggcaagctc
gagggcgagacgctcgaaaacctcatcgtcaaggtcgcgacggatgcgctcgaccatgcc
ggcatcggtccggacgaggtcgacgagatcgtgcttggccatttcaacgccggcttctcg
gcgcaggatttcaccgcgagcctggtgctgcaggccgacgaccggctgcgcttcaagccg
gcaacgcgcgtcgagaacgcctgcgcgacgggatcggcggcggtccggcaaggcatccgc
gccatcgacgccaacgcggcccgcatcgtgctggtggttggcgccgaacagatgacgacg
acgccgggacccgagatcggcaagaaccttctgaaagcgtcctatctgccggaggacggc
gagacacccgcgggcttcgccggcgtcttcggcaagatcgcgcaggcctatttccagcgt
tatggcgaccagtccgatgcgctcgccatgatcgccgccaagaaccacaagaacggcgtc
gacaatccctatgcgcagatgcgcaaggatttcggctatgatttctgccggcaggagagc
gagaagaaccccttcgtcgccggtcctctcaagcgcaccgactgctcgctggtctccgac
ggcgccgccgctcttatcctcgccgatacggccactgcgctgaagatgcgccgcgcagtt
gccttcagggccaatgaacatgtgcaggatttcctgccgatgtcgaagcgcgatattctg
gccttcgaaggctgcgagcaggcttggacccgcgcgctgaagaatgccggcgtgacgctc
gacgatctgtcctttgtcgagacgcatgactgcttcaccattgccgaactgatcgaatat
gaggccatgggcctggccaggcccggcgagggcgcgaagctggcgctggatggcacgacg
gccaaggacggccgccttccggtcaacccctccggcgggctcaaggccaagggccacccg
atcggcgccaccggtgtctccatgcatgtcctgaccgccatgcagcttgtcggcgaagcc
ggcggcattcaggtgccgggcgcgaagcttggcggcatcttcaacatgggtggcgcggcg
gtcgccaactacgtttccattctcgaccggatcaggtaa

DBGET integrated database retrieval system