KEGG   Mesorhizobium japonicum MAFF 303099: mlr7869Help
Entry
mlr7869           CDS       T00043                                 

Definition
(GenBank) unknown protein
  KO
K02339  DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
mlo  Mesorhizobium japonicum MAFF 303099
Pathway
mlo00230  Purine metabolism
mlo00240  Pyrimidine metabolism
mlo01100  Metabolic pathways
mlo03030  DNA replication
mlo03430  Mismatch repair
mlo03440  Homologous recombination
Module
mlo_M00260  DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:mlo00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    mlr7869
   00240 Pyrimidine metabolism
    mlr7869
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    mlr7869
   03430 Mismatch repair
    mlr7869
   03440 Homologous recombination
    mlr7869
Enzymes [BR:mlo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     mlr7869
DNA replication proteins [BR:mlo03032]
 Prokaryotic Type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     mlr7869
DNA repair and recombination proteins [BR:mlo03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   MMR (mismatch exicision repair)
    DNA polymerase III holoenzyme
     mlr7869
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_pol3_chi
Motif
Other DBs
NCBI-ProteinID: BAB54243
RhizoBase: mlr7869
UniProt: Q984S0
Position
6512588..6513037
Genome map
AA seq 149 aa AA seqDB search
MADVLFYHLTESTLEEALPGLLERSVDRGWRAVVQTGTEERRDALDQHLWTFRDDSFLAH
ATDREAYPDEQPILLTTSDGNPNEAKIRFLVDGAVPSDLAGYERAVFLFDGHDAAQVEAA
RGHWKTMKDAGHAVTYWQQTADRRWERKA
NT seq 450 nt NT seq  +upstreamnt  +downstreamnt
atggccgacgtgctgttctaccatctgaccgaatcgaccctggaggaggcgctgccaggc
ctgctcgagcgcagcgtcgatcgtggctggcgcgccgtggtgcagaccggcaccgaggaa
cggcgcgacgcgctcgaccagcatctgtggaccttccgcgatgactccttcctggcgcac
gcgaccgatcgcgaggcttatcccgacgagcagcctatcctgttgaccaccagcgacggc
aatcccaatgaggccaaaataaggttcctggtcgacggcgcggtaccgtccgaccttgcc
ggctacgagcgtgccgtgttcctgttcgatggccatgacgccgcccaggtcgaggcggcg
agggggcattggaagacgatgaaggacgcgggccatgccgtgacctactggcagcagaca
gcggaccgccgctgggagcgcaaggcttga

DBGET integrated database retrieval system