KEGG   Melampsora larici-populina: MELLADRAFT_38246Help
Entry
MELLADRAFT_38246  CDS       T03138                                 

Definition
(RefSeq) family 32 glycoside hydrolase
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
mlr  Melampsora larici-populina
Pathway
mlr00052  Galactose metabolism
mlr00500  Starch and sucrose metabolism
mlr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mlr00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    MELLADRAFT_38246
   00500 Starch and sucrose metabolism
    MELLADRAFT_38246
Enzymes [BR:mlr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     MELLADRAFT_38246
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C DUF4975
Motif
Other DBs
NCBI-GeneID: 18927698
NCBI-ProteinID: XP_007413668
JGI: Mellp1_38246
UniProt: F4RWM2
Position
Unknown
AA seq 764 aa AA seqDB search
MSFEYHKPSTWLSVLIIISTINLTRSHHTKNRDLIDFEKRSEASSHAIPSQVYNTSVQDT
QCDLNRHEPPQLSNLITCHDNSLFTLWRPKARFMGSRGWLNDPMAIYQTKNGSWHIGYQC
QPNNYVWGNISQCSASTTDFTYFNDYHGWQNPVTIAPSQLYDIRGVFDGSIIQKGWNGHP
TIIYTSTFTGPLGWKTQPPEKEGTETQSLAYTEDDGKTWTKLNFGENGNPVIYHWPEKHL
TGFRDPFIFESPEFLSFYSSSGSQLTGQKFLTISGGIREDLDPKNAGPRLFLYRQSYEGN
FLHWTYLGPLIELPPVLKPISSWQGATGVNFECGSLVTIEEEPQMNGTNQSGNDSFQKHP
HRLDLFLTGSEGARNGSHDDHWPIWSVLDYDFSNLDGNLKAKIKFSGVIDWGRTYAFVVF
QVEPNRQVLVGWSYEDDVQNVLTSQRGYQGSFTLFRDIFVKVIRNIAPESAYLTEKDPSW
SVEKELDGSLSVITLGQKIIPETLKAYKKESIVSKLADRTLNINSTSIESTNALLTNLVQ
FEEQPSDRYFAITAQLDFHGLTSSLDDPTNIDLQSMPRGGFRVLASESEWTDIYYEPSSE
SLVVRREHSSLVKVYGSSTEIGKLRLWPIRDPMTNTTSLESLNLTIIVDNSIIEVYANHQ
TVITTRVYPWLMNSTSVSFFVEGNPSMKNPNRSSNLTSNPKEIHSNPSVTNHSSFIPQSV
SFSNIELWNGLLNAWPNRPLNSSVLIKTSHDLTQTLYSVWDDTS
NT seq 2295 nt NT seq  +upstreamnt  +downstreamnt
atgagtttcgaataccataaaccatcaacatggctttctgtcctaattattatcagtaca
atcaacctcacaagatctcaccacaccaagaaccgagacctaatcgactttgaaaaacga
agcgaagcaagttctcatgcgattcctagtcaagtttataacacttcagttcaagacaca
caatgtgatcttaatcgtcatgaacctcctcaactatctaacttgatcacttgtcatgat
aattctttgtttactttatggagacctaaagctaggttcatgggatctcgtggttggttg
aatgaccctatggctatttatcaaaccaaaaatggttcttggcatataggctaccagtgc
cagccgaacaactatgtgtggggaaatatttctcagtgctcagcttcgactactgatttc
acttactttaatgattaccatggctggcaaaacccagtgaccatcgctccatctcaatta
tacgatattcgtggagtttttgatggaagtatcatccaaaaaggttggaacggacaccct
acgatcatctatacgtcaacttttactggtccacttggttggaaaactcaaccgcctgag
aaggaaggaactgaaactcagagtcttgcttatactgaagacgatggtaagacatggacc
aagttgaactttggagagaatggaaacccagtgatttaccattggccagaaaaacatctt
actggattcagagatccattcatattcgaatcacccgaattcttatcattttattcctca
agtggatcccaactaacaggccaaaagtttttgaccatcagtggagggattcgtgaagat
ttagatcccaagaatgcaggacctagattatttctttaccgtcaaagctatgaaggaaat
ttccttcattggacttatttaggacctttgatcgaattaccaccggttttgaaacctatt
agttcttggcaaggtgcaactggtgtgaactttgaatgtggttcattagttactattgaa
gaagagcctcaaatgaacggaaccaaccagagtggtaatgattcttttcaaaaacatcct
catcggcttgatcttttcttgactggatctgaaggagctcgaaatggatctcatgatgat
cattggccgatttggagtgtattagattacgatttttcaaatcttgatggaaacttaaag
gctaaaatcaagttttcaggtgtgattgattggggtaggacttatgcatttgtagttttt
caagttgaacctaatcgacaagttcttgtaggttggagttatgaagacgatgttcagaac
gtattgacttctcaaagaggttatcaaggttcatttactctatttcgagatatctttgta
aaagtgattcggaatatcgcaccagagtcggcttacttgactgagaaagatccaagttgg
agtgtcgaaaaagaattggatggttctttatccgttatcactcttggacaaaaaatcatt
cctgaaaccttaaaagcatacaaaaaagaatcaattgtttctaaactggctgatcgtact
ttgaacattaatagtactagtatagaaagtaccaatgcgcttcttacaaatctagtccaa
tttgaagaacagccatcagatcggtattttgctatcaccgctcaactcgactttcatggc
ttgacctcaagcttggatgatcccacaaacatagatcttcaaagcatgcctcgtggtggg
ttcagagttttggccagcgaaagtgaatggacagatatctattatgagccttcatctgaa
tcactcgttgtgcgccgtgaacacagttctttggtgaaagtttatgggagttctactgag
ataggaaaactaagactttggccaattcgagatccaatgaccaacaccacctctttagaa
tcacttaacctaactatcattgtagacaacagtattatagaagtatacgcaaatcatcaa
acagtcatcactactcgagtttacccttggttgatgaattctacatcagtttcatttttc
gtagaaggaaatccatcaatgaagaacccaaatcgatcatctaatcttacttctaatcca
aaagaaattcattccaatcctagtgtcaccaaccattcaagttttattcctcaatctgtt
tctttttcaaatattgaactatggaatggtttgctaaacgcttggccaaatcgaccttta
aattcttctgtacttattaaaactagtcatgatcttactcaaactctttattctgtttgg
gatgatacgtcataa

DBGET integrated database retrieval system