KEGG   Melampsora larici-populina: MELLADRAFT_44167Help
Entry
MELLADRAFT_44167  CDS       T03138                                 

Definition
(RefSeq) family 32 glycoside hydrolase
  KO
K01193  
beta-fructofuranosidase [EC:3.2.1.26]
Organism
mlr  Melampsora larici-populina
Pathway
Galactose metabolism
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mlr00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    MELLADRAFT_44167
   00500 Starch and sucrose metabolism
    MELLADRAFT_44167
Enzymes [BR:mlr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     MELLADRAFT_44167
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 661 aa AA seqDB search
MMGSRGWLNDPMGIYQKKDGSWHIGYQCQPNNYVWGNVSQCSASTNDFTYFNDYRSWEDP
TTIAPSALYDIRGVFDGSIIKEGWNGHPTLIYTSTFAGTLGWQSQPPEKEGTETQSIAFT
EDDGLTWTKLNFGQNGNPIIYHWPEKHLTGFRDPYIFESEEFSEYYSNSSIQHQVPNNGV
TPTGKKFLTISGGIRADFEPSNAGPRLFLYRQTKDESVLDWTYLGPLLTLPPIFSPVSPW
QGGSGVNFECGTLSSIDENGRKTSKNETDNEDLHHLNLFIVGTEGARNGSHHDYWPIWHA
LKYDYDSPDGNVKAHVEFSGVVDWGTSYAYSQFAGADNRQLLVGWCYEDDEYNILSYQRG
YQGAFTLFRDIFVKVIRGILPTAPELNEKDPNWKVITEKDGSKSIVTLGQKIVPEIIAGY
KKQSSITKLEDRTLDVGVVGDEKSRPMNLVGFETQPTDKYFAITAQLDFHGSSNNATNID
RSSMVRGGFRVLSSDREWTDIYYDPSTESMVVSRLNSSLIQAYGNETEAGRLRLWPIQDP
VMNTISLQSLNLTIVVDNSIVEVYANDQTVITTRVYPWLLNSNAVTFFVQAPDSFKKVKL
DDDQALSNQNSTFIPQSVTFSNVELWDGLLNAWPNRPRDTSLPGIFSHNITSTIYGLWSD
I
NT seq 1986 nt NT seq  +upstreamnt  +downstreamnt
atgatgggatctcgtggttggttgaatgaccctatgggtatttatcaaaagaaggatggt
tcttggcacataggctaccagtgccagcccaacaactatgtgtggggaaatgtatctcag
tgctcagcctcgaccaatgacttcacatacttcaatgattatcgcagctgggaagatcct
accacaatcgcaccctcggcactatacgacattcgaggagtcttcgatggtagtattatc
aaagaagggtggaatggacatcctactctcatatacacttcgacctttgctggaacactt
ggttggcagagtcagccaccagagaaagaaggcactgaaactcagagcattgctttcact
gaagacgatgggctcacctggactaaactcaactttggtcaaaatggaaacccaattatc
taccattggccagaaaaacatttgactggattcagagacccatatatatttgagtctgaa
gaattctcggagtattattctaactcttccatacaacaccaggtcccaaataacggtgtc
acacctacaggcaaaaagttcttaactatcagtggaggtatccgtgctgattttgaacca
tctaacgctggacctcgattatttttgtatcgccaaaccaaggatgaaagtgtgcttgat
tggacataccttggaccacttcttactttacctccaatattttctcctgttagcccttgg
caaggtggttcgggagtcaatttcgaatgtggaactttatcgagcatcgatgagaatgga
aggaagacttcaaagaatgagactgataacgaagatcttcatcatcttaatttattcatt
gttggtaccgaaggcgctcgtaatgggtctcatcatgactattggccgatttggcatgcg
ttgaagtatgattatgattcgcctgatggaaacgttaaagcacatgttgaattctccgga
gtcgtcgactggggtacatcatacgcttattcacaatttgcaggtgcagataaccgtcag
cttctagttggatggtgttacgaagatgatgagtacaacatcctaagttatcaaaggggt
tatcaaggtgcattcaccttattccgagatatcttcgtaaaggtcattcgaggaatttta
ccaacagccccggaattaaatgaaaaggatcctaattggaaggtgatcactgaaaaggat
ggttctaaatctattgtcactcttggtcaaaaaatagtacctgagattatagcaggatac
aaaaagcaatctagtatcaccaagcttgaagatagaactttggatgtcggtgtggttgga
gatgaaaagagtcgacctatgaatttggtcggatttgaaactcaacctactgataaatac
tttgcaatcactgcacaacttgactttcatggttcatccaacaatgccaccaacattgat
cgctccagcatggttaggggtgggtttagggtactttccagcgatagggaatggacagac
atctactatgacccttcaactgagtcgatggtcgtctcgcgtctcaatagctcccttatt
caggcctatgggaatgaaactgaagcaggcagactcagactttggccaattcaagaccct
gtgatgaacacaatttcattacaatctctcaacttgaccatcgtagtggataacagtatt
gttgaagtatacgcaaatgatcaaacagtcatcaccacccgagtttatccttggttactc
aactcaaatgctgtgacattctttgttcaagcacccgattctttcaagaaggtcaaactt
gatgatgatcaagcactcagcaatcaaaattcaaccttcattcctcaatctgtcactttt
tctaatgttgaattatgggatggacttttgaacgcttggccaaaccgacctcgtgatacc
tcattgcccggaatctttagtcataatatcaccagtactatttatggcttatggtcagat
atttga

DBGET integrated database retrieval system