KEGG   Melampsora larici-populina: MELLADRAFT_72914Help
Entry
MELLADRAFT_72914  CDS       T03138                                 

Definition
(RefSeq) hypothetical protein
  KO
K00326  cytochrome-b5 reductase [EC:1.6.2.2]
Organism
mlr  Melampsora larici-populina
Pathway
mlr00520  Amino sugar and nucleotide sugar metabolism
Brite
KEGG Orthology (KO) [BR:mlr00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    MELLADRAFT_72914
Enzymes [BR:mlr01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     MELLADRAFT_72914
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NAD_binding_1 FAD_binding_6 NAD_binding_6
Motif
Other DBs
NCBI-GeneID: 18932231
NCBI-ProteinID: XP_007414895
JGI: Mellp1_72914
UniProt: F4S0N5
Position
Unknown
AA seq 346 aa AA seqDB search
MFVWSTIRQVGTHAYSTASSKPTTVTSSGSLKWIAMGGVGLGAGYWMFKSKGISPLEAKQ
LEDKAKNTLASITSGSGSASQAALSPEEWRDFKLQKVIPYNHNTSTFVFELPKNVPSGLT
IASALITKSVAKDGELACTDDKGKLVIRPYTPTTPPDQHDTLHLLVKKYTEGKMTNHIHN
LKPGDSLSMKGPIPKWAYKANEFKTIGMIAGGSGITPHWQIIQEIASNPEDQTKVILFFS
NQKEEDILLREEFEKLQKEKPHQFSINFVLDNPPKGWSSDLKGYLTASLLKSKLPSPKLG
SDTKIFVCGPPGQVSAISGPKKGKDQGELGGILKELGYTQDQVYKF
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgtttgtgtggtctacgattcgtcaggtcggcacccacgcctactcaacggcctcttcg
aaacccaccacggtcaccagctcagggtcactcaaatggatcgcgatgggcggtgtaggc
cttggagccggatattggatgttcaaatccaaaggcatctctcctttggaagccaaacaa
ctggaggataaggccaagaacacccttgctagtatcacgtccggttctggctctgcatct
caagctgctctgagccccgaggaatggcgagatttcaagttgcagaaagtgattccatac
aatcacaacacatccacgttcgttttcgaattaccgaagaatgtgccatccggactcacc
atcgcgtcagctttaatcacaaagtcagtcgcgaaagatggtgaattggcatgtacggat
gataagggaaaacttgtcatcaggccctacacgcccactacgcctccagatcaacatgac
actttacacttgctcgtaaagaagtataccgaaggcaagatgactaaccacatccacaac
ttgaagccaggagattcgctatccatgaagggccccattcccaaatgggcttacaaggcc
aacgagttcaaaactataggaatgattgcgggtgggagtggtatcacgccacactggcag
atcatccaggaaatcgcatctaaccccgaggatcagaccaaggtgattctgtttttttct
aaccagaaggaggaagatattctcctacgagaagagtttgaaaaacttcagaaggagaaa
ccccatcagttctccatcaattttgtcttggataacccgccaaagggttggtcaagtgac
ttaaaaggatacctgacagcctccctgctcaaatcgaagctaccatcccccaagctagga
tcggacacgaagatctttgtctgtggtccacctgggcaagttagtgccatctcgggtccg
aagaagggtaaagaccagggagagctgggtggtatcctgaaagaacttgggtacactcaa
gaccaggtttataaattctaa

DBGET integrated database retrieval system