KEGG   Melampsora larici-populina: MELLADRAFT_85788Help
Entry
MELLADRAFT_85788  CDS       T03138                                 

Definition
hypothetical protein
Orthology
K00326  
cytochrome-b5 reductase [EC:1.6.2.2]
Organism
mlr  Melampsora larici-populina
Pathway
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mlr00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    MELLADRAFT_85788
Enzymes [BR:mlr01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     MELLADRAFT_85788
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 364 aa AA seqDB search
MEETVTRRLPFDIYGLKAKELTLPLRKWALAVPFDPHLNFGASTGPIAPTKIAACTIQSQ
HHTLKTNVSSHPTSKYLPSTYQPRKAHLQLFEGFSMDSTQLLPIILAVVALAMASYFLAP
KSEPTLSPEDYRPFTLKSKTKISPNTAIYRFSLPSEKHILGLPIGQHISIRAEINGKNVQ
RSYTPVSSDDDRGYFDLLIKTYDQGNISKYVANLQVGDSIQVRGPKGQMKYHAELCNKIG
MIAGGTGITPMLQIIRACAKDPKDNTQISLIYANVNEEDILLKQELDEIHSKHPKKFSAK
WNGGVGFVSKEMIAEKLPSATEDSIKILLCGPPPMTTAMKKYLEELDYEKCKVVSKLNDQ
VFCF
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atggaagagactgtaacaaggaggcttccctttgatatttatggattgaaggcaaaggag
cttacactaccactgcggaagtgggctttggctgttccgttcgatccccacttgaacttc
ggcgcttcgacgggcccaatagccccaaccaaaattgctgcatgtacgatccaatcgcag
catcacactttgaaaactaacgtctcatcgcatccaacgtccaaatatttgcccagtaca
taccaaccgaggaaagctcaccttcagctatttgaaggtttcagtatggatagtactcaa
cttttacctatcatcttggctgtggtagcacttgcaatggcttcatatttcttagcacca
aaatccgaacccactctctcaccagaagattatagaccattcactttaaaatctaaaaca
aaaatctctccaaacacagctatctatcgattctcattaccatctgaaaaacatattttg
ggacttcctatcggtcaacatatttcaattcgtgctgaaatcaatggtaaaaacgttcaa
agaagttatacccctgtatcaagtgatgatgatcgaggttattttgatttattgatcaag
acatacgatcaaggaaatatatcaaaatatgtagccaacttacaagtcggtgattcgatt
caagtgagaggaccaaaaggacaaatgaaataccatgcagagctttgcaataagatcgga
atgattgcaggtggaacaggtatcacacctatgctacaaatcatccgagcttgtgccaaa
gatcctaaggacaacactcaaatctcattgatctatgccaacgtcaacgaagaagatatc
cttttaaaacaagagctagacgaaatccactcaaaacaccctaagaaattctcggcaaaa
tggaatggtggggttggatttgttagtaaagagatgattgccgaaaaattaccatcagct
acagaagattctattaagatcttattatgtggtcctcctccaatgacaacagcgatgaaa
aagtatttagaagaattagattatgaaaaatgtaaagtagtgagcaaattgaatgatcaa
gttttctgcttttga

DBGET integrated database retrieval system