KEGG   Micrococcus luteus: Mlut_01250Help
Entry
Mlut_01250        CDS       T00918                                 

Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
mlu  Micrococcus luteus
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:mlu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Mlut_01250
Enzymes [BR:mlu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     Mlut_01250
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
135421..136041
Genome map
AA seq 206 aa AA seqDB search
MTAHTPDDAVPGTFDPDSTAVDRPRIEAAVREILLAIGEDPDREGLADTPARVAKAYAEF
FAGLHQSPDQVLGTTFDIAHEELVLVKDIPFYSTCEHHLVPFHGAAHIGYIPSAEGRVTG
LSKLARLVELYARRPQVQERLTTQVVEALMEHLAPRGAIVVVEAEHMCMSMRGVRKPGAK
TVTSAVRGQLRDPSTRSEAMSLIMHG
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgacagcccacacccccgacgacgccgtccccggcacgttcgacccggactcgaccgcg
gtcgaccggccgcgcatcgaggcggcggtgcgggagatcctgctggcgatcggtgaggac
ccggaccgcgagggcctggcggacaccccggcgcgggtggccaaggcgtacgcggagttc
ttcgcgggcctgcaccagagcccggaccaggtgctcggcaccacgttcgacatcgcgcac
gaggagctcgtgctcgtgaaggacatcccgttctactcgacgtgcgagcaccacctggtg
ccgttccacggcgccgcgcacatcggctacatcccctccgccgagggccgcgtgacgggg
ctgtccaagctggcccgcctcgtggagctgtacgcgcggcgtccgcaggtgcaggagcgg
ctgaccacgcaggtggtggaggcgctcatggagcacctggccccgcgcggggcgatcgtg
gtggtggaggccgagcacatgtgcatgtccatgcgcggcgtgcgcaagccgggcgcgaag
accgtcacctcggcggtgcgcggccagctgcgggatccgtccacgcgctccgaggcgatg
agcctcatcatgcacggctga

DBGET integrated database retrieval system