KEGG   Micrococcus luteus: Mlut_01260Help
Entry
Mlut_01260        CDS       T00918                                 

Definition
Dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
mlu  Micrococcus luteus
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:mlu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Mlut_01260
Enzymes [BR:mlu01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     Mlut_01260
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
136068..136985
Genome map
AA seq 305 aa AA seqDB search
MDESIDAAAREANRALLGRLPADRTLVMGILNVTPDSFSDGGEHATVRAALDHARRMVAD
GADIVDVGGESTRPGARAVPPAEEQARILPVIEALLAEDVVVSVDTRHTATARAALALGP
VIVNDVSGLAHEAEMPALIAASGAPYILMHNRGNPQTMDGLAVYADTVPDVVCELRDVAG
RFLAAGVEPAQLIVDPGLGFAKAGEQNWELLRGLEWLRAMGHPVLVAASRKRFLGTLLAD
DDGAPAPPAARDAATAAISALAAAQGAWGVRVHDVRASADAVRTAAAWVGAHAPPGEPVS
EDVLP
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
gtggacgagagcatcgacgcggcggcgcgggaggcgaaccgcgccctgctggggcggctg
cccgcggaccggaccctggtcatgggcatcctcaatgtcacccctgactcgttctcggac
ggcggggagcacgccaccgtccgcgcggctctcgaccacgcccggcgcatggtcgcggac
ggcgcggacatcgtggacgtgggcggcgagtccacccgccccggggcccgcgccgtgccg
ccggccgaggagcaggcgcgcatcctgcccgtgatcgaggcgctgctggccgaggacgtc
gtcgtctccgtggacacgcgccacaccgccaccgcccgggccgccctggcgctggggccg
gtgatcgtcaacgacgtctccggcctcgcccacgaggcggagatgccggcgctgatcgcc
gcgtcgggcgcgccatacatcctcatgcacaaccgcgggaacccgcagaccatggacggt
ctggccgtctacgcggataccgtcccggacgtcgtgtgcgagctgcgggacgtggccggc
cgcttcctcgccgcgggcgtcgagcccgcgcagctgatcgtggacccgggcttgggcttc
gcgaaggccggcgagcagaactgggagctgctgcgcggcctcgagtggctccgcgccatg
ggccatccggtgctcgtcgccgcctcgcgcaagcggttcctgggcaccctgctggcggac
gacgacggcgccccggccccgcccgccgcgcgcgacgccgccaccgcggcgatctccgcc
ctcgccgccgcccagggcgcgtggggcgtgcgcgtgcatgacgtgcgcgccagcgccgac
gccgtccgcacggccgccgcttgggtcggggcgcatgccccgccgggtgagcccgtctcc
gaggacgtgctgccgtga

DBGET integrated database retrieval system