KEGG   Micrococcus luteus: Mlut_02080Help
Entry
Mlut_02080        CDS       T00918                                 

Definition
(GenBank) isocitrate lyase
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
mlu  Micrococcus luteus
Pathway
mlu00630  Glyoxylate and dicarboxylate metabolism
mlu01100  Metabolic pathways
mlu01110  Biosynthesis of secondary metabolites
mlu01120  Microbial metabolism in diverse environments
mlu01200  Carbon metabolism
Module
mlu_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:mlu00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Mlut_02080
Enzymes [BR:mlu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     Mlut_02080
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase
Motif
Other DBs
NCBI-ProteinID: ACS29769
UniProt: C5C8G7
Position
218565..219872
Genome map
AA seq 435 aa AA seqDB search
MTTQPHHSTPASAEQLQHDWDNNPRWAGVERSFTAEDVVRLRGRIQEEHTLARRGAEKLW
TQLKDENARGEFTNALGALTGNQAVQQVKAGLRAIYLSGWQVAADANLSGHTYPDQSLYP
ANSVPQVVRRINNALLRADQIEHAEGVSSVEDWLVPIVADAEAGFGGPLNAYELMKSMIT
AGASGVHWEDQLASEKKCGHLGGKVLIPTGQHIRTLNAARLAADVADVPSVIIARTDAEA
ATLITSDVDERDAEFITGERTAEGFYKVRNGVEPCIARAKAYAPHADLIWMETGTPDLEL
ARKFAEAVKAEFPDQMLAYNCSPSFNWKKNLDDDTIAKFQRELGAMGYTFQFITLAGFHA
LNHSMFDLAKGYNERQMSAYVELQEREFADEARGYTATKHQREVGTGYFDAVSTAINPDS
STVALAGSTESGQFH
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgaccacccagccccaccactccactcccgcctccgccgaacagctccagcacgactgg
gacaacaacccccgctgggccggcgtcgagcgcagcttcaccgccgaggacgtcgtccgt
ctccgcggccgcatccaggaggagcacacgctggcccgccgcggtgccgagaagctgtgg
acccagctgaaggacgagaacgcccgcggtgagttcaccaacgccctcggcgccctcacc
ggcaaccaggccgtccagcaggtcaaggccgggctgcgcgccatctacctctccggctgg
caggtcgccgcggacgccaacctctccggccacacgtacccggaccagtccctgtacccg
gccaactccgtgccgcaggtggtgcgccgcatcaacaacgccctgctgcgcgcggaccag
atcgagcacgccgagggcgtcagcagcgtcgaggactggctcgtgccgatcgtggccgac
gccgaggctggcttcggcggcccgctcaacgcctacgagctcatgaagtcgatgatcacg
gccggcgcctccggcgtgcactgggaggaccagctggcctccgagaagaagtgcggccac
ctcggcggcaaggtgctcatccccaccggccagcacatccgcacgctcaacgccgcccgc
ctggccgccgacgtcgccgacgtgcccagcgtgatcatcgcccgcaccgacgccgaggcg
gccacgctgatcacctcggacgtggacgagcgcgacgccgagttcatcaccggtgagcgc
accgcggagggcttctacaaggtccgcaacggcgtcgagccctgcatcgcccgcgccaag
gcctacgccccgcacgcggacctgatctggatggagaccggcacgccggacctcgagctg
gcccggaagttcgccgaggccgtcaaggccgagttcccggaccagatgctggcctacaac
tgctcgccgtcgttcaactggaagaagaacctcgacgacgacaccatcgccaagttccag
cgcgagctgggcgccatgggctacaccttccagttcatcacgctggccggcttccacgcc
ctgaaccactcgatgttcgacctggccaagggatacaacgagcgccagatgtccgcgtac
gtcgagctgcaggagcgcgagttcgccgacgaggcccgcggctacaccgcgaccaagcac
cagcgcgaggtcggcaccggctacttcgacgccgtgtccaccgccatcaacccggacagc
tccacggtggccctggcgggctccacggagtccggccagttccactga

DBGET integrated database retrieval system