KEGG   Micrococcus luteus: Mlut_02090Help
Entry
Mlut_02090        CDS       T00918                                 

Definition
(RefSeq) malate synthase A
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
mlu  Micrococcus luteus
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:mlu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mlut_02090
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Mlut_02090
   00630 Glyoxylate and dicarboxylate metabolism
    Mlut_02090
Enzymes [BR:mlu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Mlut_02090
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
219906..221669
Genome map
AA seq 587 aa AA seqDB search
MSPQTTTPTLHEIHADDVREHTPLPHDVSTQAIPVVIPEGAAPVVTVHGPVDGRQAEILT
DEALAFLGRLHRLAEDRRRRLLEEREYTRRRITDGWNPHYLRSTRRVREDDSWRVAPLAP
GLQDRRVEITGPVDRKMTINALNSGASGWLADFEDSSTPSWDRMLDGQVNLFDAIRDQID
FTSPEGKEYRLRERELTDRPTIIVRPRGWHLLEDHIRVDGEPMAGALVDFGLYFFHNADE
LIRRGHGPYFYLPKLESHLEARLWNCVFVAAQDELGIPQGTIRATVLIETITAAFQMEEI
LYQLRNHAAGLNAGRWDYIFSIIKNFRDRGAEFVLPDRSEVTMTQPMMRAYTEQLVRACH
RRGASAIGGMSAVIPDRRNEEANAAALEKVRADKAREAGDGFDGSWVAHPDLVPVAREEF
DAVLGEAPNQIRTRRREDVVPDEAALLDVAATTGSVTEAGVRMNIEVGIRYIESWLRGNG
AAAIHGLMEDAATAEISRSQIWQWAHNGTGVQLTEGGVRTANRGWMEQLIREEHARILAG
PLPEGHRFEDAVRVFCESALPPEYPAFLTVGAYRRHFAGQDDAAAKA
NT seq 1764 nt NT seq  +upstreamnt  +downstreamnt
atgagcccgcagaccacgacccccaccctgcacgagatccatgccgacgacgttcgggag
cacacgcccctgccgcatgacgtgagcacccaggccatccccgtcgtcatccccgagggc
gccgcccccgtggtgaccgtccacgggccggtcgacgggcggcaggccgagatcctcacg
gacgaggcgctggcgttcctcggccgcctgcaccggctggccgaggaccgccgccggcgg
ctgctcgaggagcgggagtacacccggcgccgcatcaccgacggatggaacccgcactac
ctgcggtccacccgccgggtccgcgaggacgactcctggcgtgtggcgccgctggccccc
ggcctgcaggaccgccgcgtggagatcaccggccccgtggatcggaagatgacgatcaac
gccctcaactcgggcgcctcgggctggctcgccgacttcgaggactcctcgacgccgtcc
tgggaccggatgctggacgggcaggtcaacctgttcgacgcgatccgcgaccagatcgac
ttcacctcccccgagggcaaggagtaccggctgcgcgagcgcgagctcacggaccggccg
accatcatcgtccgcccgcgcggctggcacctcctcgaggaccacatccgtgtggacggc
gagccgatggccggcgccctcgtggacttcggcctgtacttcttccacaacgccgacgag
ctgatccgccgcggccacggcccgtacttctacctgcccaagctcgagtcccatctcgag
gcgcggctgtggaactgcgtgttcgtggcggcgcaggacgagctgggcatcccccagggc
accatccgggccaccgtgctgatcgagacgatcaccgcggcgttccagatggaggagatc
ctgtaccagctgcgcaaccatgccgctggcctgaacgccggccgctgggactacatcttc
tccatcatcaagaacttccgggaccgcggggccgagttcgtcctcccggaccgctcggag
gtgaccatgacccagccgatgatgcgggcctacacggagcagctggtccgggcctgccac
cggcgcggcgcctcggcgatcggcggcatgtccgccgtgatcccggaccgccggaacgag
gaggccaacgccgccgcgctggagaaggtgcgcgcggacaaggcccgcgaggccggcgac
ggcttcgacggctcgtgggtggcgcacccggacctcgtgccggtcgcccgggaggagttc
gatgccgtgctcggcgaggccccgaaccagatccgcacccgccgccgcgaggacgtggtg
ccggacgaggccgccctgctcgacgtcgccgcgaccacgggctcggtgaccgaggccggc
gtgcggatgaacatcgaggtcgggatccgctacatcgagtcctggctgcgggggaacggc
gccgccgcgatccacggactcatggaggacgccgccacggcggagatctcccggtcccag
atctggcagtgggcacacaacggcaccggtgtgcagctgaccgagggcggcgtgcggacc
gccaaccgcggctggatggagcagctgatccgcgaggagcacgctcggatcctcgccggc
ccgctgcccgagggccaccggttcgaggacgcggtgcgcgtgttctgcgagtcggccctg
ccgccggagtacccggcgttcctcaccgtgggcgcgtaccggcgccacttcgccggccag
gacgacgccgcggcgaaggcctga

DBGET integrated database retrieval system