KEGG   Micrococcus luteus: Mlut_02120Help
Entry
Mlut_02120        CDS       T00918                                 

Definition
thymidine kinase
Orthology
K00857  
thymidine kinase [EC:2.7.1.21]
Organism
mlu  Micrococcus luteus
Pathway
Pyrimidine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:mlu00240]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
223583..224224
Genome map
AA seq 213 aa AA seqDB search
MAKLYFRYGAMNSGKSTGLLQAAFNYEERGQRVLLAKPEVDVKGEGDVVSRLGVTRAVDF
LVPAGADVRELFRRHATGDDPDALVGHVEAPPVACLLVDEAQFLEPAQVDDLLRIAVLDG
VPVIAYGLRTDFRTRSFPGSARLLELAHSLEELKTICRCGRKAVFNTRKVVDPATGAEHF
VFEGDQVAIDGVQVTYESLCGTCYLAESGGALG
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
gtggccaagctctacttccgctacggggccatgaactccggcaagtccacgggcctgctg
caggccgccttcaactacgaggagcgcggccagcgggtgctgctggccaagccggaggtg
gacgtgaagggggagggcgacgtcgtgtcccgcctcggtgtgacccgcgccgtggacttc
ctcgtcccggcgggagcggacgtgcgggagctgttccgccggcacgccaccggtgacgac
ccggacgccctcgtggggcacgtggaggctccgcccgtggcgtgccttctcgtggacgag
gcgcagttcctcgagccggcgcaggtggacgacctgctgcgcatcgccgtgctcgacggc
gtccccgtgatcgcctacgggctgcgcaccgacttccgcacccgctccttcccgggctcc
gcgcggctgctggagctggcgcactccctcgaggagctgaagaccatctgccggtgcggc
cggaaggcggtgttcaacacgcgcaaggtcgtggacccggccacgggcgccgagcacttc
gtgttcgagggggaccaggtggcgatcgacggtgtccaggtgacctacgagtccctgtgc
ggcacgtgctacctggcggagtccggcggtgccctgggctga

DBGET integrated database retrieval system