KEGG   Micrococcus luteus: Mlut_02640Help
Entry
Mlut_02640        CDS       T00918                                 

Definition
DNA replication and repair protein RecR
Orthology
K06187  
recombination protein RecR
Organism
mlu  Micrococcus luteus
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:mlu00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Mlut_02640
DNA repair and recombination proteins [BR:mlu03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Mlut_02640
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(284946..285545)
Genome map
AA seq 199 aa AA seqDB search
MYQGAVQDLIDELGRLPGIGPKSAQRIAFHMLEADREDMLRLADAIRTVKDRVRLCSVCF
NVSEDEVCSLCRDERRDRSQICVVEESQDVMAMERTRAFQGRYHVLGGAINPIAGIGPEQ
LHVRELLTRLQDEAVQEVILATDPNLEGEATATYLGRLLGATGIRVTRLASGLPVGGDLE
YADEVTLGRAFEGRRLISG
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgtaccagggcgcggtgcaggacctgatcgacgaactcggccgcctgccgggcatcggc
ccgaagtccgcccagcgcatcgccttccacatgctggaggcggaccgggaggacatgctg
cggctcgcggacgccatccgcacggtcaaggacagggtgcggctgtgctcggtctgcttc
aacgtctccgaggacgaggtgtgctcgctctgccgggatgaacgccgggaccgctcccag
atctgcgtggtcgaggagtcgcaggacgtcatggccatggagcgcacccgcgccttccag
ggccggtaccacgtgctcggcggggccatcaatccgatcgccggcatcggccccgagcag
ctgcacgtccgcgagctgctcacccggctgcaggacgaggccgtgcaggaggtcatcctc
gccacggatcccaacctcgagggcgaggccacggccacctacctcggccggctcctcggc
gccacgggcatccgcgtcacgcgcctggcctccggtctgcccgtcggcggggacctcgag
tacgcggacgaggtcaccctcggccgtgccttcgagggacgccgcctgatcagcggctga

DBGET integrated database retrieval system