KEGG   Micrococcus luteus: Mlut_02640Help
Entry
Mlut_02640        CDS       T00918                                 

Definition
DNA replication and repair protein RecR
Orthology
K06187  
recombination protein RecR
Organism
mlu  Micrococcus luteus
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:mlu03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(284946..285545)
Genome map
AA seq 199 aa AA seqDB search
MYQGAVQDLIDELGRLPGIGPKSAQRIAFHMLEADREDMLRLADAIRTVKDRVRLCSVCF
NVSEDEVCSLCRDERRDRSQICVVEESQDVMAMERTRAFQGRYHVLGGAINPIAGIGPEQ
LHVRELLTRLQDEAVQEVILATDPNLEGEATATYLGRLLGATGIRVTRLASGLPVGGDLE
YADEVTLGRAFEGRRLISG
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgtaccagggcgcggtgcaggacctgatcgacgaactcggccgcctgccgggcatcggc
ccgaagtccgcccagcgcatcgccttccacatgctggaggcggaccgggaggacatgctg
cggctcgcggacgccatccgcacggtcaaggacagggtgcggctgtgctcggtctgcttc
aacgtctccgaggacgaggtgtgctcgctctgccgggatgaacgccgggaccgctcccag
atctgcgtggtcgaggagtcgcaggacgtcatggccatggagcgcacccgcgccttccag
ggccggtaccacgtgctcggcggggccatcaatccgatcgccggcatcggccccgagcag
ctgcacgtccgcgagctgctcacccggctgcaggacgaggccgtgcaggaggtcatcctc
gccacggatcccaacctcgagggcgaggccacggccacctacctcggccggctcctcggc
gccacgggcatccgcgtcacgcgcctggcctccggtctgcccgtcggcggggacctcgag
tacgcggacgaggtcaccctcggccgtgccttcgagggacgccgcctgatcagcggctga

DBGET integrated database retrieval system