KEGG   Micrococcus luteus: Mlut_03270Help
Entry
Mlut_03270        CDS       T00918                                 

Definition
formamidopyrimidine-DNA glycosylase
Orthology
K05522  
endonuclease VIII [EC:3.2.2.- 4.2.99.18]
Organism
mlu  Micrococcus luteus
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:mlu03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(354496..355437)
Genome map
AA seq 313 aa AA seqDB search
MPEGDSLVRVAHRLRPVLEGRVLTHADLRVPRHATADLTGWTVAEVLPRAKYLLMRLTPP
TARPGARPLTLISHLKMEGRWLVSAVDARWGAPAWQVRAVLETAGHRVLGAQLGLLTLVP
TADEATVLGHLGPDLLDPAWDTPDDGAALLAEGVRRLTARPERPVGLALLDQRLVSGIGN
IYRCETLLLAGIDPHRPVGEVEDVAGLVLLARDLLRANVPPAAPAAGARRRTTGVRPNPG
RPFGVEVLVPAGPPPGTTPGRTPGARGGGTPSYWVYGHDRAPCLRCRGPVRQEDYGSAED
DARRLWWCPHCQG
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
gtgcctgaaggcgactccctcgtccgcgtcgcgcaccggctccgccccgtgctcgagggc
cgggtcctgacgcacgcggatctgcgcgtgccccgccacgccaccgcggacctgaccggc
tggacggtggccgaggtcctgccgcgcgccaagtacctgctgatgcggctgaccccgccc
acggcccgccccggggcccggccgctcaccctgatctcgcacctgaagatggaggggcgc
tggctcgtctcggccgtcgacgcgcggtggggcgcccccgcctggcaggtgcgggcggtg
ctggagacggcggggcaccgcgtgctcggcgcccagctgggcctgctcaccctcgtgccc
accgccgacgaggccaccgtcctcggccacctcggccccgacctgctcgacccggcctgg
gacacccccgacgacggcgccgcgctgctcgccgagggcgtgcggcggctcacggcccgg
cccgagcggccggtcggcctggccctgctcgaccagcggctcgtctccgggatcggcaac
atctaccgctgcgagaccctcctgctggccggcatcgacccgcaccggccggtcggggag
gtcgaggacgtcgccggactcgtgctgctcgcccgggacctgctgcgcgccaacgtcccg
cccgccgcccccgccgcgggcgcacggcgccggaccacgggcgtgcgtcccaacccgggg
cgacccttcggggtcgaggtgctggtcccggccggtccgccacccggcacgacgcccggc
cggacgcccggcgcgcgcggcggggggacgccgtcgtactgggtctacgggcacgaccgc
gccccgtgcctgcgctgccgcggccccgtccgccaggaggactacggctccgccgaggac
gacgcgcggcggctgtggtggtgcccgcactgccagggctga

DBGET integrated database retrieval system