KEGG   Micrococcus luteus: Mlut_03720Help
Entry
Mlut_03720        CDS       T00918                                 

Definition
(RefSeq) phosphoglycerate mutase (EC:5.4.2.1)
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
mlu  Micrococcus luteus
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:mlu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mlut_03720
   01230 Biosynthesis of amino acids
    Mlut_03720
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mlut_03720
  Energy metabolism
   00680 Methane metabolism
    Mlut_03720
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Mlut_03720
Enzymes [BR:mlu01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Mlut_03720
Exosome [BR:mlu04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Mlut_03720
  Exosomal proteins of melanoma cells
   Mlut_03720
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
402550..403308
Genome map
AA seq 252 aa AA seqDB search
MANTTYTLVLLRHGQSEWNEKNLFTGWVDVPLTEKGRAEAARGGELLEAEGIHPDVVHTS
LLKRAITTANLALEAADRQWIPVKRSWRLNERHYGALQGKDKAQVKEEFGEEQFMVWRRS
FDTPPPALDDDSEFSQAGDERYADLGKDAPRTEALKQVIDRLLPYWEEQVLPDLKAGKTV
LIAAHGNSLRALVKHLDGISDEDIAGLNIPTGIPLVYELDQNFKPITANGRYLDPEAAAA
GAAAVAAQGSAH
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atggcgaacaccacgtacacgctggtcctgctgcggcacggtcagagcgaatggaacgag
aagaacctgttcaccggctgggtggacgtcccgctgaccgagaaggggcgcgccgaggcc
gcccgcggcggtgagctgctggaggcggagggcatccacccggacgtggtccacacgtcc
ctgctcaagcgcgccatcaccacggccaacctggccctcgaggccgcggaccgccagtgg
atcccggtcaagcgcagctggcgcctgaacgagcgccactacggcgccctccagggaaag
gacaaggcccaggtgaaggaggagttcggcgaggagcagttcatggtctggcgccgctcc
ttcgacaccccgccgcccgccctggacgacgactccgagttctcccaggccggcgacgag
cgctacgcggacctgggcaaggacgccccccgcaccgaggccctcaagcaggtcatcgac
cgcctgctgccctactgggaggagcaggtcctgcccgacctcaaggccggcaagaccgtg
ctgatcgccgcgcacggcaactcgctgcgcgcgctggtcaagcacctggacggcatctcg
gacgaggacatcgcgggcctgaacatcccgacgggcatcccgctggtctacgagctggac
cagaacttcaagccgatcaccgcgaacggccgctacctcgacccggaggccgccgcggcc
ggcgccgccgccgtggccgcccagggctccgcgcactga

DBGET integrated database retrieval system