KEGG   Micrococcus luteus: Mlut_03850Help
Entry
Mlut_03850        CDS       T00918                                 

Definition
alpha-1,4-glucan:alpha-1,4-glucan 6-glycosyltransferase (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
mlu  Micrococcus luteus
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mlu00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Mlut_03850
Enzymes [BR:mlu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Mlut_03850
Exosome [BR:mlu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Mlut_03850
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
416854..419184
Genome map
AA seq 776 aa AA seqDB search
MTPSAAPRPAVAPLAVDPEVLAAVAQGRHHDPHTVLGAHPHPDGAAVTYRVLRPLARTVT
VVRAGDGQRVELTHEHDGVFAGVAPTPRVAGAAAGDYRVEVVYETEDGTTGPVQEQDDAY
RHLPTLGELDLHLIGEGRHERLWEVLGARVVRTSADEAVGTAFAVWAPNARAVRVVGDHN
GWDGRTHAMRSLGSSGVWELLAPGVGHGDRYKFEILGRDGLWRQKADPMARWTEVPPATA
SRVLESDYAFGDRTWMERRRVTDPHERPLSIYEVHLGSWRPGLDYRELAEQLVEYVQWLG
FTHVEFLPVAEHPFGGSWGYQVTGYYAPTSRFGSPDEFKHLVDALHQAGIGVIVDWVPAH
FPKDEWALARFDGTALYEHPDPRRGEHPDWGTLVFDFGRTEVRNFLVANALYWLGEFHID
GLRVDAVASMLYLDYSREDGQWEPNVHGGNHNLEAIDFLREVNATVYRLHPGVHMIAEES
TAFSGVSAPVDAGGLGFGKKWNMGWMHDTLAYLSQDPVNRRWHHGQWTFSMVYAYSENYV
LPLSHDEVVHGKGSLLGRIPGDRRQQLATLRAYYGYMWAHPGKQLLFMGGEYAQPSEWSE
GEGLDWPVSWDEAHRGVQLTIRELNALYRSKPALWSLDHSPEGFSWVDGGDADGNTLVFL
RMPAAQVVPEPRIDDDGDAVPAAEPGGAPLLCITNLSGSPRQGLRVGVPSAGEWTVVLDT
DAIDFHGDGWREQTGQSEVVTAHEGQWQGQPAHVTVNVPALTTLWLQPNPDTTGTH
NT seq 2331 nt NT seq  +upstreamnt  +downstreamnt
atgaccccgtccgccgccccccgtcccgccgtcgccccgctcgccgtggacccggaggtg
ctggccgccgtcgcgcagggccggcaccacgatccgcacaccgtgctgggcgcccacccg
catcccgacggcgccgcggtcacctaccgtgtgctgcgcccgctggcgcgcacggtcacg
gtggtccgcgccggcgacgggcagcgggtggagctgacgcacgagcacgacggcgtgttc
gcgggcgtggccccgacgccccgcgtggccggggccgccgcaggcgactaccgcgtcgag
gtggtgtacgagaccgaggacggcacgaccggccccgtccaggagcaggacgacgcgtac
cggcacctgcccacgctcggcgagctggacctgcacctgatcggggagggccggcacgaa
cggctgtgggaggtgctcggcgcgcgcgtggtccgcacctccgccgacgaggccgtcggc
acggccttcgcggtctgggcgccgaacgcgcgggccgtgcgcgtggtgggcgaccacaac
ggctgggacggccggacccacgccatgcggtccctcggctcctccggcgtgtgggagctg
ctggcgcccggcgtcggtcacggcgaccgctacaagttcgagatcctcggccgggacggg
ctctggcggcagaaggcggacccgatggcccgctggacggaggtccccccggccacggcc
tcgcgtgtgctggagtccgactacgccttcggggaccgcacctggatggagcgccgccgc
gtcacggacccgcacgagcgcccgctgagcatctacgaggtgcacctgggctcgtggcgg
cccgggctcgactaccgcgagctggccgagcagctcgtggagtacgtgcagtggctgggg
ttcacgcacgtggagttcctgccggtcgcggagcatccgttcggcgggtcctggggctac
caggtgaccggctactacgcccccacctcccggttcggctccccggacgagttcaagcac
ctggtggacgcgctgcaccaggcggggatcggcgtcatcgtggactgggtgccggcgcac
ttcccgaaggacgagtgggcgctcgcgcgcttcgacgggaccgccctgtacgagcacccg
gacccgcggcggggcgagcatccggactggggcaccctcgtgttcgacttcggccgcacc
gaggtccgcaacttcctcgtggccaacgcgctctactggctcggcgagttccacatcgac
gggctgcgtgtggacgccgtcgcctcgatgctctacctggactactcgcgcgaggacggg
cagtgggagcccaacgtgcacggcggcaaccacaacctcgaggccatcgacttcctgcgc
gaggtcaacgcgaccgtgtaccgcctgcaccccggcgtccacatgatcgcggaggagtcc
acggccttctccggggtgagcgctcccgtggacgcgggcggtctcggcttcggcaagaag
tggaacatgggctggatgcacgacaccctggcctacctgtcccaggacccggtcaaccgc
cggtggcaccacgggcagtggacgttctccatggtgtacgcctactcggagaactacgtg
ctgccgctgtcccacgacgaggtcgtccacggcaagggctctctgctgggccgcatcccg
ggcgaccgccggcagcagctggccaccctgcgcgcctactacgggtacatgtgggcgcac
cccggcaagcagctgctgttcatgggcggggagtacgcgcagccgagcgagtggtccgag
ggagagggcctggactggcccgtctcatgggacgaggcgcaccgcggggtccagctgacg
atccgggagctcaacgcgctctaccgcagcaagccggcgctgtggtcgctggaccacagc
ccggaaggattctcgtgggtggacggcggcgacgctgacggcaacacgctcgtattcctc
cgcatgcccgcggcgcaggtggtgccggagccgcggatcgacgacgacggcgacgcggtc
ccggccgccgaaccgggcggcgccccgctgctgtgcatcaccaacctctcggggtcgccg
cgtcagggcctccgggtgggggtgccgtccgcgggggagtggacggtggtgctggacacc
gacgcgatcgacttccacggagacggctggcgggagcagaccggccagtccgaggtggtc
actgcccatgagggccagtggcagggccagccggcccacgtcacggtgaacgtgccggcg
ctgaccaccctgtggctccagccgaacccggacacgacgggcacgcactga

DBGET integrated database retrieval system