KEGG   Micrococcus luteus: Mlut_04350Help
Entry
Mlut_04350        CDS       T00918                                 

Definition
agmatinase (EC:3.5.3.7)
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
mlu  Micrococcus luteus
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mlu00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Mlut_04350
Enzymes [BR:mlu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     Mlut_04350
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
471129..472145
Genome map
AA seq 338 aa AA seqDB search
MLEIPRVEDNGRLGPVNSALVPRYGGAPTYALLSRLDEAAAAGVAPEIKVVGVPFDAGVS
YRPGARFGSGHVRQSSRLLRPYNPATDTSPFAQAQVVDAGDMAVNPFNIGEAIEAIQQDA
MDLTEDGSSLMTIGGDHTIALPLLRAASARAGEPVALLHFDAHLDTWDTYFGAEYTHGTP
FRRAVEEGILDTEAISHVGTRGPLYGKKDLDDDHRMGFGIVTSSDVFRQGVDEIVDQLRQ
RIGGRPLYISVDIDVLDPAHAPGTGTPEAGGITSRELLEILRGLRGLDIVGADLVEVAPA
YDHAELTGVAASHVAYDLISLMADRRATRAAAGEEPGR
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgctcgagatcccccgcgtcgaggacaacggacgcctcggccccgtgaactccgccctc
gtgccccgctacggcggtgcccccacctacgcgctgctgtcgcgcctggacgaggcggcc
gcggccggcgtcgccccggagatcaaggtggtcggcgtgccgttcgacgccggcgtctcc
taccgccccggtgcacgcttcgggtccggccacgtgcggcagtcctcgcggctgctgcgc
ccgtacaacccggccacggacacctcgcccttcgcacaggctcaggtggtggacgccggc
gacatggcggtgaacccgttcaacatcggcgaggccatcgaggcgatccagcaggacgcg
atggacctcaccgaggacggctcctcactcatgaccatcggcggcgaccacaccatcgcg
ctgccgctgctgcgcgccgcctccgcccgggcgggtgagcccgtggccctgctgcacttc
gacgcccacctggacacgtgggacacctacttcggcgccgagtacacccacggcacgccg
ttccgccgcgccgtggaggaggggatcctggacaccgaggccatctcgcatgtgggcacc
cgcggtccgctctacggcaagaaggacctcgacgacgaccaccgcatgggcttcggcatc
gtcacctcctcggatgtgttccgtcagggcgtggacgagatcgtggaccagctgcgccag
cgcatcgggggccggccgctctacatctcggtggacatcgacgtcctcgaccccgcgcac
gccccgggcaccggaacccccgaggccggcggcatcacgagccgcgagctgctcgagatc
ctgcgtgggctgcgcgggctggacatcgtgggcgcggacctggtggaggtggccccggcc
tacgaccacgccgagctgaccggcgtcgccgcctcccatgtggcctatgacctcatctcc
ctgatggccgaccgccgcgccacccgcgcggccgccggtgaggagccgggccgatga

DBGET integrated database retrieval system