KEGG   Micrococcus luteus: Mlut_04940Help
Entry
Mlut_04940        CDS       T00918                                 

Definition
thymidine phosphorylase
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
mlu  Micrococcus luteus
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mlu00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Mlut_04940
Enzymes [BR:mlu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     Mlut_04940
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
541938..543272
Genome map
AA seq 444 aa AA seqDB search
MTAQPQAEPFDAVEVIRAKRDRGTLSPEQIDWVVDAYTRGVVADEQMSALAMAILLNGMD
RAEIARWTDAMIASGERMDFGGLTTPDGRPLATADKHSTGGVGDKITLPLAPLVASFGVA
VPQLSGRGLGHTGGTLDKLEAIPGWRADLSNEAMLRQLSEVGAVICAAGSGLAPADKRLY
ALRDVTGTVEAIPLIASSIMSKKIAEGTGALVLDVKCGSGAFMKDEASARELARTMVDLG
RDAGVDTSALLTDMSVPLGRTAGNALEVRESVEVLAGGGPADVVELTVALAAAMLAGAGV
TDVDPAEHLANGRAMDVWNRMIEAQGGDPRAALPTAAHAEDVVAETDGVLTELDAMAVGL
AAWRLGAGRERQGQAVQAAAGVEVHVRPGERVARGQKVLTLHTDTPERFERAKAALAGGW
AVGELDDAAARTLRERSVILDRIG
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcgcagccgcaggccgagcccttcgacgccgtcgaggtgatccgcgccaagcgg
gaccgggggacgctgtcccccgagcagatcgactgggtggtggacgcgtacacccgcggc
gtggtggcggacgagcagatgtccgccctggccatggcgatcctgctcaacggcatggac
cgcgccgagatcgcccgctggacggacgcgatgatcgcctcgggcgagcgcatggacttc
ggcgggctcaccaccccggacggccgccccctggccaccgcggacaagcactccaccggc
ggcgtgggggacaagatcaccctgccgctggcccccctcgtggcctccttcggggtggcc
gtgccgcagctgtccggccgcggcctcggccacaccggcggcaccctggacaagctcgag
gcgatccccgggtggcgggccgacctcagcaacgaggcgatgctgcgccagctctccgag
gtgggcgccgtgatctgcgcggccggctcgggcctggccccggcggacaagcgcctgtac
gcactgcgcgacgtcacgggcacggtggaggccatccccctgatcgcctcctcgatcatg
tccaagaagatcgccgagggcaccggcgccctcgtgctggacgtcaagtgcggctcgggc
gcgttcatgaaggacgaggcgtccgcccgcgagctggcccggaccatggtggacctcggc
cgggacgccggggtggacacctcggcgctgctcacggacatgtccgtgcccctgggccgg
acggccggcaacgccctcgaggtccgcgagtcggtggaggtgctcgccggcggcggcccg
gccgacgtcgtggagctcaccgtggcgctcgccgccgcgatgctcgccggcgccggggtc
acggacgtggacccggccgagcacctggccaacggccgggcgatggacgtgtggaaccgg
atgatcgaggcccagggcggcgacccgcgcgcggccctcccgacggcggcccacgccgag
gacgtcgtcgcggagacggacggcgtcctcaccgagctggacgcgatggccgtgggcctg
gccgcgtggcgcctcggcgccgggcgggagcggcagggccaggccgtccaggccgcggcc
ggcgtcgaggtgcacgtgcgccccggcgagcgcgtggcccggggtcagaaggtcctgacc
ctgcacacggacacgccggagcgcttcgagcgggcgaaggccgcgctcgccggcggctgg
gccgtcggcgagctcgacgacgccgccgcccggaccctgcgcgagcgctccgtgatcctg
gaccggatcggctga

DBGET integrated database retrieval system