KEGG   Micrococcus luteus: Mlut_05400Help
Entry
Mlut_05400        CDS       T00918                                 

Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
mlu  Micrococcus luteus
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
C5 isoprenoid biosynthesis, non-mevalonate pathway
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:mlu00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
588986..589954
Genome map
AA seq 322 aa AA seqDB search
MTTEDLGLDPTARHVTVSAPGKVNLSLRVGPPGADGYHPVATVYLAVSLRETVTAIARTD
GRITVGPLGRHISLVDTEDVPWDERNLAHRAAAHLRRTLGLDPDTHGVHLEVAKQVPVAG
GMGGGSADAAAALLACSVLWETGHTRAELAELAAPLGADVPFSVLGGAAVGLGTGAELTP
VAARTPLHLVLVPADAGLSTPAVFQTLDELRREGHLPDGPARPEVNEAVLRALTAADPLA
LATAMDNDLQTPAVVLFPELSDVLDLGLDEGALRGMVSGSGPTLLFVVQDEASALRLASA
IEERTGVRALPVHGPVPGAHVL
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgacgacggaggacctcggcctcgaccccacggcccggcacgtcacggtcagcgccccc
ggcaaggtgaacctgtccctgcgggtggggccgcccggcgcggacggctaccaccccgtg
gccaccgtgtacctggccgtcagcctgcgggagaccgtcacggcgatcgcgcgcacggac
gggaggatcaccgtcggcccgttgggccgccacatcagtctggtggacaccgaggacgtg
ccctgggacgagcgcaacctcgcgcaccgcgccgccgcgcacctgcggcgcaccctcggg
ctcgatcctgacacccacggcgtccacctcgaggtcgccaagcaggtcccggtcgcgggt
ggcatgggcggcggctccgccgacgcggccgccgcgctgctcgcgtgcagcgtcctgtgg
gagaccgggcacacccgcgccgaactcgccgagctggccgccccgctgggcgcggacgtg
cccttcagcgtgctgggcggcgccgccgtcgggctcgggaccggggccgagctgaccccc
gtcgcggcccgcaccccgctgcacctcgtcctcgtcccggcggacgccgggctgtccacc
cccgcggtgttccagaccctggacgagctgcgccgggagggccacctgcccgacgggccg
gcgcgccccgaggtgaacgaggccgtcctgcgggccctcaccgcggccgacccgctcgca
ctcgccaccgccatggacaacgacctgcagaccccggccgtcgtcctgttccccgagctc
tcggacgtcctcgacctcggtctggacgagggcgcgctgcgcggcatggtctccggctcc
ggccccaccctgctcttcgtggtgcaggacgaggcctccgcgctgcggctggcctcggcc
atcgaggagcgcacgggcgtgcgcgccctccccgtccacggccccgtgcccggcgcccac
gtgctgtga

DBGET integrated database retrieval system