KEGG   Micrococcus luteus: Mlut_06920Help
Entry
Mlut_06920        CDS       T00918                                 

Definition
1-deoxy-D-xylulose 5-phosphate reductoisomerase (EC:1.1.1.267)
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
mlu  Micrococcus luteus
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:mlu00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Mlut_06920
Enzymes [BR:mlu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     Mlut_06920
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
748137..749402
Genome map
AA seq 421 aa AA seqDB search
MTHGSLTDYTLPAPAPADDDGVPRAVALIGSTGSIGTQGLDVIAQDPARLRAVALAGGAN
TTLLAEQAVRFEVEAVGSAAAGQEELRAALADAAARLGRPAPRPVLFTGPCAAEEIAAWP
GADTVLNGITGSIGLRPTLAALHAGHRLALANKESLIVGGALVKAAAAPGQLVPVDSEHS
ALAQALRGGTADEVRRLVLTASGGPFRGLDRAALHAVTPAQALAHPTWDMGRVVTTNSAS
LVNKALEVIEAHLLFDVPLDRIDVVVHPQSVVHSMVEFVDGSTLAQASPPDMRLPIALGL
CWPRRLPGAAPACDWTRAATWTFEPLDEEAFPAVRAAKEAAAASPTHMAVFNAANEESVD
AFHAGALPFDGIVDTVRAVVADYAPEHVLAEAGHDPAPTGLTVDAVLAAEAWARRAARAR
W
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
gtgacgcacggatccctcaccgactacacgctgcccgctcccgccccggcggacgacgac
ggcgtcccgcgcgccgtcgccctgatcggctccacgggctcgatcggcacccagggcctc
gacgtgatcgcccaggaccccgcccggctccgggccgtcgcgctcgcgggcggggcgaac
acgaccctgctggccgagcaggccgtgcgcttcgaggtcgaggcggtgggctccgccgcg
gcgggacaggaggagctgcgggccgccctcgccgacgccgccgcccgcctcgggcgcccg
gccccccggcccgtgctgttcaccggtccgtgcgccgccgaggagatcgccgcgtggccc
ggcgccgacaccgtgctgaacgggatcacgggctcgatcggcctgcggcccaccctcgcc
gcgctgcacgccggccaccgcctggccctggccaacaaggagtcgctcatcgtcggcggg
gccctcgtgaaggccgccgcggcaccagggcagctcgtgccggtggactccgagcactcc
gcgctcgcgcaggcgctgcgcggtggcacggcggacgaggtccgccgcctcgtgctcacg
gcctcaggcgggccgttccgcggcctggaccgcgccgccctgcacgccgtcacgcccgcc
caggccctcgcccaccccacgtgggacatgggccgcgtcgtcaccaccaactccgcctcc
ctcgtgaacaaggccctcgaggtgatcgaggcccacctgctgttcgacgtgcccctggac
cggatcgacgtcgtggtccacccgcagtccgtggtccactcgatggtcgagttcgtcgac
gggtccacgctcgcccaggcctccccgccggacatgcgcctgcccatcgccctggggctg
tgctggccgcgccgtctcccgggcgcagccccggcctgcgactggacgcgggcggccacc
tggacgttcgagcccctcgacgaggaggccttccccgcggtacgggccgcgaaggaggcg
gcggccgcctcgcccacccacatggccgtgttcaacgccgccaacgaggagtccgtggac
gccttccacgccggcgccctgcccttcgacgggatcgtggacacggtccgcgccgtcgtc
gccgactatgcccccgagcacgtgctcgccgaggccggccacgaccccgcgccgacgggg
ctcaccgtggatgccgtgctcgccgccgaggcctgggcgcgccgtgcggcgcgggcccgc
tggtga

DBGET integrated database retrieval system