KEGG   Micrococcus luteus: Mlut_08030Help
Entry
Mlut_08030        CDS       T00918                                 

Definition
threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
mlu  Micrococcus luteus
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:mlu01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:mlu00260]
Metabolism; Metabolism of cofactors and vitamins; Vitamin B6 metabolism [PATH:mlu00750]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
868665..869777
Genome map
AA seq 370 aa AA seqDB search
MAHQWRGVVREYADRLPVTEDTRVITLGEGGTPLIHAPHLSELVQGTVHVKFEGMNPTGS
FKDRGMTMAITAAVTDGAKAVVCASTGNTSASAAAYAAQAGITCAVLVPEGKISMGKMSQ
AVAHGAEILQVQGNFDDCLEVARKLAENYPVFLVNSVNPARIEGQKTGAFEVVDTLGDAP
DYHLLPVGNAGNITAYWKGYREYAAPYVNPHEGASDAELPAVATKTPVMWGFQAAGAAPI
VQGHPVTDPDTIATAIRIGNPASWEQAEAARDESGGMIDSVTDEEILEAHRWLSAKEGVF
VEPASAAGVAGLLKHHAAGNVPAGKSWVITVTGHGLKDPQWALRGADGADVTPRSVPFDV
VTVAQALGLS
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atggcccaccagtggcgcggcgtcgtccgcgagtacgccgaccgcctgcccgtcaccgag
gacacgcgcgtgatcaccctcggcgagggcggcaccccgctcatccacgccccccacctc
tccgagctggtgcagggcaccgtgcacgtgaagttcgagggcatgaacccgaccggctcc
ttcaaggaccgcggcatgaccatggcgatcaccgccgccgtcacggacggcgcgaaggcc
gtcgtctgcgcatccaccggcaatacgtccgcctcggcggcggcctacgcggcgcaggcc
gggatcacgtgcgccgtgctcgtgcccgaggggaagatctcgatgggcaagatgtcccag
gccgtggcccacggcgcggagatcctccaggtgcagggcaacttcgacgactgcctcgag
gtggcccgcaagctggccgagaactaccccgtgttcctggtgaactccgtcaacccggcc
cgcatcgaagggcagaagaccggtgcattcgaggtcgtggacaccctcggcgacgccccg
gactaccacctgctgcccgtgggcaacgccggaaacatcaccgcgtactggaagggctac
cgcgagtacgccgccccctacgtgaacccgcacgagggcgcctcggacgccgagctgccc
gcggtggccacgaagacccccgtgatgtggggcttccaggccgcgggcgccgccccgatc
gtccagggccaccccgtgaccgacccggacacgatcgccaccgccatccggatcggcaac
ccggcctcgtgggagcaggccgaggccgcccgcgacgagtccggcggcatgatcgactcc
gtcacggacgaggagatcctcgaggcccatcgctggctctccgcgaaggagggcgtgttc
gtcgagcccgcctccgccgccggcgtcgccgggctgctcaagcaccacgccgccgggaac
gtgccggccggcaagagctgggtcatcaccgtcaccggccacggcctcaaggacccgcag
tgggccctgcgcggcgccgacggcgccgacgtgaccccgcgctcggtgccgttcgacgtg
gtcaccgtcgcccaggcgctcggcctgagctga

DBGET integrated database retrieval system