KEGG   Micrococcus luteus: Mlut_08030Help
Entry
Mlut_08030        CDS       T00918                                 

Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
mlu  Micrococcus luteus
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:mlu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Mlut_08030
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Mlut_08030
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Mlut_08030
Enzymes [BR:mlu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Mlut_08030
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
868665..869777
Genome map
AA seq 370 aa AA seqDB search
MAHQWRGVVREYADRLPVTEDTRVITLGEGGTPLIHAPHLSELVQGTVHVKFEGMNPTGS
FKDRGMTMAITAAVTDGAKAVVCASTGNTSASAAAYAAQAGITCAVLVPEGKISMGKMSQ
AVAHGAEILQVQGNFDDCLEVARKLAENYPVFLVNSVNPARIEGQKTGAFEVVDTLGDAP
DYHLLPVGNAGNITAYWKGYREYAAPYVNPHEGASDAELPAVATKTPVMWGFQAAGAAPI
VQGHPVTDPDTIATAIRIGNPASWEQAEAARDESGGMIDSVTDEEILEAHRWLSAKEGVF
VEPASAAGVAGLLKHHAAGNVPAGKSWVITVTGHGLKDPQWALRGADGADVTPRSVPFDV
VTVAQALGLS
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atggcccaccagtggcgcggcgtcgtccgcgagtacgccgaccgcctgcccgtcaccgag
gacacgcgcgtgatcaccctcggcgagggcggcaccccgctcatccacgccccccacctc
tccgagctggtgcagggcaccgtgcacgtgaagttcgagggcatgaacccgaccggctcc
ttcaaggaccgcggcatgaccatggcgatcaccgccgccgtcacggacggcgcgaaggcc
gtcgtctgcgcatccaccggcaatacgtccgcctcggcggcggcctacgcggcgcaggcc
gggatcacgtgcgccgtgctcgtgcccgaggggaagatctcgatgggcaagatgtcccag
gccgtggcccacggcgcggagatcctccaggtgcagggcaacttcgacgactgcctcgag
gtggcccgcaagctggccgagaactaccccgtgttcctggtgaactccgtcaacccggcc
cgcatcgaagggcagaagaccggtgcattcgaggtcgtggacaccctcggcgacgccccg
gactaccacctgctgcccgtgggcaacgccggaaacatcaccgcgtactggaagggctac
cgcgagtacgccgccccctacgtgaacccgcacgagggcgcctcggacgccgagctgccc
gcggtggccacgaagacccccgtgatgtggggcttccaggccgcgggcgccgccccgatc
gtccagggccaccccgtgaccgacccggacacgatcgccaccgccatccggatcggcaac
ccggcctcgtgggagcaggccgaggccgcccgcgacgagtccggcggcatgatcgactcc
gtcacggacgaggagatcctcgaggcccatcgctggctctccgcgaaggagggcgtgttc
gtcgagcccgcctccgccgccggcgtcgccgggctgctcaagcaccacgccgccgggaac
gtgccggccggcaagagctgggtcatcaccgtcaccggccacggcctcaaggacccgcag
tgggccctgcgcggcgccgacggcgccgacgtgaccccgcgctcggtgccgttcgacgtg
gtcaccgtcgcccaggcgctcggcctgagctga

DBGET integrated database retrieval system