KEGG   Micrococcus luteus: Mlut_08310Help
Entry
Mlut_08310        CDS       T00918                                 

Definition
nicotinamidase-like amidase
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
mlu  Micrococcus luteus
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Nicotinate and nicotinamide metabolism [PATH:mlu00760]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(894910..895593)
Genome map
AA seq 227 aa AA seqDB search
MENLNRALVIVDVQNDFCEGGALGVTGGAAVAAGVSEHLAEHADAYAAVAATRDWHVDPG
THFAAATGAEPDFRTTWPVHCVAGTAGAELHPDLDAEHLDAEFLKGLHTDAYSGFDGALG
EPDAVPTGAAGERPSGTVGPYGATAVAAAAVESGAPGLDEWLREQGVDAITVVGIATDHC
VRATVLDALDAGYEVTVLTDLVAGVDEAAAQAALHEMEAAGAVLATS
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atggagaacctgaaccgcgccctggtgatcgtggacgtgcagaacgacttctgcgagggc
ggcgccctcggcgtgaccggcggcgccgccgtcgcggccggggtcagcgagcacctggcc
gagcacgcggacgcctacgcggccgtggccgccacgcgcgactggcacgtcgacccgggc
acgcacttcgccgcggccaccggcgccgagccggacttccgcaccacctggccggtgcac
tgtgtggccggcaccgccggcgccgagctgcatcccgacctggacgccgagcacctcgac
gccgagttcctcaagggcctgcacacggacgcctactccggcttcgacggcgccctcggc
gagcccgacgccgtcccgaccggggccgcgggcgagcgcccctccgggacagtcggcccg
tacggggccaccgccgtggccgcggccgccgtcgagtccggcgcccccggcctcgacgag
tggctccgtgagcagggcgtggacgcgatcaccgtggtgggcatcgcgacggatcactgc
gtgcgcgccaccgtgctcgacgccctcgacgccggctacgaggtcacggtgctgaccgac
ctggtggccggcgtcgacgaggcagccgctcaggccgcgctccacgagatggaggccgcc
ggggccgtcttggcgacctcgtga

DBGET integrated database retrieval system