KEGG   Micrococcus luteus: Mlut_08870Help
Entry
Mlut_08870        CDS       T00918                                 

Definition
UDP-glucose pyrophosphorylase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
mlu  Micrococcus luteus
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:mlu00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Mlut_08870
   00052 Galactose metabolism
    Mlut_08870
   00500 Starch and sucrose metabolism
    Mlut_08870
   00520 Amino sugar and nucleotide sugar metabolism
    Mlut_08870
Enzymes [BR:mlu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Mlut_08870
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
957874..958788
Genome map
AA seq 304 aa AA seqDB search
MTVPPPSRPRTRKAVIPAAGLGTRFLPATKAMPKEMLPVVDRPAIEYVVTEARRAGLADV
LMITGRNKRALEDHFDRHPALEAVLERKGDAKRLAQIHESDLVGDIHYVRQGEALGLGHA
VNCARRHVGEEPFAVLLGDDIIGDGEALLERMIDVQQRLGGSVIALMEVPEEAVSAYGVA
AVEAVPGEGDDVVRVTDLVEKPAREDAPSTLAIIGRYVLAPQVFDVLDETPPGRGGEIQL
TDALQRLATEDGEGRGVHAVVFDGRRYDTGDKLGYLQAVIEFGTRHEDLGADLRAWLREF
TAGL
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgaccgtcccgcccccttcccgcccccgcacccgcaaggccgtgatcccggccgccggc
ctgggcacccgcttcctgccggccaccaaggccatgccgaaggagatgctgccggtggtg
gaccggccggccatcgagtacgtggtgacggaggcccggcgtgcgggcctcgcggacgtg
ctgatgatcacaggccggaacaagcgggccctcgaggaccacttcgaccgccatcccgcg
ctggaggccgtgttggagcgcaagggcgacgccaagcggctcgcgcagatccacgagtcg
gacctggtgggggacatccactacgtccgtcagggcgaggccctcgggctcggccacgcg
gtgaactgcgcacgccgccacgtcggcgaggagccgttcgcggtcctgctgggcgatgac
atcatcggcgacggcgaggcgctgctcgagcgcatgatcgacgtgcagcagcgcctcggc
ggctccgtgatcgccctcatggaggtcccggaggaggccgtctcggcctacggcgtggcc
gcggtggaggccgtgccgggggagggcgacgacgtcgtccgcgtcaccgacctcgtggag
aagccggcccgcgaggacgccccctccaccctcgcgatcatcggccgctacgtgctggcc
ccgcaggtgttcgacgtgctggacgagaccccgcccggccgcggcggggagatccagctc
accgatgcgctccagaggctggccacggaggacggcgagggccgcggcgtgcacgccgtc
gtcttcgacggccgccgctacgacacgggggacaagctcggctacctgcaggcggtcatc
gagttcgggacgcggcacgaggacctcggggccgacctgcgggcctggctccgggagttc
accgccgggctctga

DBGET integrated database retrieval system