KEGG   Micrococcus luteus: Mlut_08910Help
Entry
Mlut_08910        CDS       T00918                                 

Definition
DNA-(apurinic or apyrimidinic site) lyase/Formamidopyrimidine-DNA glycosylase
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
mlu  Micrococcus luteus
Pathway
Base excision repair
Brite
KEGG Orthology (KO) [BR:mlu00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    Mlut_08910
Enzymes [BR:mlu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.23  DNA-formamidopyrimidine glycosylase
     Mlut_08910
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     Mlut_08910
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
960482..961399
Genome map
AA seq 305 aa AA seqDB search
MPELPEAEVVRRGLARWATDAVAAELEVLDPRSLRRSPGGADALRERLRGARLAEPARRG
KFLWLPLAEGDDAVVVHLGMSGQILVDEPGAADQRHLRLRLPVTAADGSARELRFVDQRI
FGGWWLDALRPDDAAGGERIPTTAAHIALDPLHPLFDPAAVHARLARRRSTLKRALLDQS
LVSGIGNIYADEALWGARLHPERPTERMRRADTLRLLAAVQDVMRRALEVGGTSFDALYV
NVDGRSGYFARSLAAYGRTGQPCRRCAAEGVDSRIVREPFMNRASHLCPRCQPRPRRRRA
AAADA
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
gtgccggagctgcccgaggccgaggtcgtccggcgcggcctggcccggtgggccacggac
gccgtcgccgcggagctcgaggtcctcgacccccgctcgctgcgtcgcagccccggaggc
gcggacgccctccgggagcggctgcgcggcgcccggctggccgagccggctcgccgcggc
aagttcctctggctgcccctggccgagggcgacgacgccgtcgtcgtgcacctggggatg
agcgggcagatcctcgtggacgaaccgggggccgccgaccagcgtcacctgcgcctgcgc
ctgcccgtcaccgcggcggacggctccgcccgcgagctgcggttcgtggaccagcggatc
ttcggcggctggtggctcgacgcgctgcggcccgacgacgccgccgggggcgagcggatc
cccaccacggccgcccacatcgccctggacccgctgcacccgctgttcgaccccgcggcc
gtgcacgcgcgcctggcacggcgccgctccaccctcaagcgcgcgttgctggaccagtcg
ctggtctccgggatcggcaacatctacgcggacgaggccctctggggcgcccgcctgcac
cccgagcgcccgaccgagcgcatgcgccgggcggacacgctgcgcctcctggcggccgtc
caggacgtgatgcgccgggccctggaggtggggggcacgagcttcgacgcgctctacgtc
aacgtggacgggcgatcgggctacttcgcccgctccctggcggcctacgggcgcaccggg
cagccgtgtcgccgctgcgccgccgagggggtcgactcccgcatcgtgcgcgagccgttc
atgaaccgtgcgagccacctgtgcccgcgctgccagcccaggccgcgccgtcgccgggcc
gcggcggccgacgcctga

DBGET integrated database retrieval system