KEGG   Micrococcus luteus: Mlut_08910Help
Entry
Mlut_08910        CDS       T00918                                 

Definition
DNA-(apurinic or apyrimidinic site) lyase/Formamidopyrimidine-DNA glycosylase
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
mlu  Micrococcus luteus
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:mlu03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
960482..961399
Genome map
AA seq 305 aa AA seqDB search
MPELPEAEVVRRGLARWATDAVAAELEVLDPRSLRRSPGGADALRERLRGARLAEPARRG
KFLWLPLAEGDDAVVVHLGMSGQILVDEPGAADQRHLRLRLPVTAADGSARELRFVDQRI
FGGWWLDALRPDDAAGGERIPTTAAHIALDPLHPLFDPAAVHARLARRRSTLKRALLDQS
LVSGIGNIYADEALWGARLHPERPTERMRRADTLRLLAAVQDVMRRALEVGGTSFDALYV
NVDGRSGYFARSLAAYGRTGQPCRRCAAEGVDSRIVREPFMNRASHLCPRCQPRPRRRRA
AAADA
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
gtgccggagctgcccgaggccgaggtcgtccggcgcggcctggcccggtgggccacggac
gccgtcgccgcggagctcgaggtcctcgacccccgctcgctgcgtcgcagccccggaggc
gcggacgccctccgggagcggctgcgcggcgcccggctggccgagccggctcgccgcggc
aagttcctctggctgcccctggccgagggcgacgacgccgtcgtcgtgcacctggggatg
agcgggcagatcctcgtggacgaaccgggggccgccgaccagcgtcacctgcgcctgcgc
ctgcccgtcaccgcggcggacggctccgcccgcgagctgcggttcgtggaccagcggatc
ttcggcggctggtggctcgacgcgctgcggcccgacgacgccgccgggggcgagcggatc
cccaccacggccgcccacatcgccctggacccgctgcacccgctgttcgaccccgcggcc
gtgcacgcgcgcctggcacggcgccgctccaccctcaagcgcgcgttgctggaccagtcg
ctggtctccgggatcggcaacatctacgcggacgaggccctctggggcgcccgcctgcac
cccgagcgcccgaccgagcgcatgcgccgggcggacacgctgcgcctcctggcggccgtc
caggacgtgatgcgccgggccctggaggtggggggcacgagcttcgacgcgctctacgtc
aacgtggacgggcgatcgggctacttcgcccgctccctggcggcctacgggcgcaccggg
cagccgtgtcgccgctgcgccgccgagggggtcgactcccgcatcgtgcgcgagccgttc
atgaaccgtgcgagccacctgtgcccgcgctgccagcccaggccgcgccgtcgccgggcc
gcggcggccgacgcctga

DBGET integrated database retrieval system