KEGG   Micrococcus luteus: Mlut_10140Help
Entry
Mlut_10140        CDS       T00918                                 

Definition
glutamate 5-kinase
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
mlu  Micrococcus luteus
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:mlu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Mlut_10140
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Mlut_10140
Enzymes [BR:mlu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     Mlut_10140
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1093401..1094606
Genome map
AA seq 401 aa AA seqDB search
MSVRRTVVTRYPTPATRGSEDPQANPVTSRETMQAARRVVVKIGSSSLTTPDGLDVAAID
RLVDVLAAERQKGTQVVLVSSGAIAAGFPHLGLGRRPKDTATQQASAAVGQSKLMAHYTT
SFGRHDTEVAQVLLTAEELMRRTQYTNAHRALSRLLTLDVMPIVNENDAVATREIRFGDN
DRLAALTANLCKADLLVLLSDVDALYTGHPSHPDARRIPEVTSDDDLAGVDVRVPGSAGV
GTGGMVTKVDAAGIAATTGIPTLLTSAANAGAAFAGEDVGTWFSATGRRRSARAAWLGLT
AEVRGRLVIDDGAVAGAIDRGRSLLAAGITGCTGDFTPGDVVEIVDAHGRVRARGLVQYS
SSQLPAMLGRTTADLRQDLGAGYDGVVVHADDWVRLTPPQR
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgtccgtgcggcgcaccgtcgtcacccgctatccgacccccgccacgcgcggctctgag
gacccgcaggccaaccccgtgacctcgcgggagacgatgcaggccgcacgccgagtggtc
gtgaagatcggttcgtcctcgttgaccaccccggacggcctggacgtggcggccatcgac
cggctcgtggacgtcctcgccgccgagcggcagaagggcacccaggtggtgctcgtgtcc
tccggcgccatcgcggccggcttcccccacctcgggctgggccgacgccccaaggacacc
gccacccagcaggcctcggcggcggtcggccagagcaagctcatggcgcactacaccacg
agcttcggccggcacgacaccgaggtggcccaggtgctcctgaccgccgaagagctcatg
cggcgcacccagtacacgaacgcgcaccgcgccctgtcgcggctgctcacgctcgatgtg
atgccgatcgtgaacgagaacgacgccgtggccacgcgcgagatccgcttcggcgacaac
gaccgcctcgcggccctcaccgccaacctctgcaaggcggacctgctggtcctgctctcg
gacgtggacgcgctctacacgggccacccctcccacccggacgcgcggcgcatcccggag
gtcacctcggacgacgatctggccggcgtcgacgtgcgtgtgcccggttccgcgggcgtg
ggcacgggcggcatggtgaccaaggtggacgcggccggcatcgcggccaccaccggcatc
ccgaccctgctcacctcggccgcgaacgcgggcgccgcgttcgcgggggaggacgtgggc
acgtggttctccgccaccggccgccgccggtccgcacgcgcggcgtggctcggcctcacg
gcggaggtccggggccggctcgtcatcgacgacggcgcggtggccggggcgatcgaccgc
ggccgctccctgctggccgcgggcatcaccggctgcacgggcgacttcacgccgggcgac
gtcgtcgagatcgtggacgcgcacggccgggtgcgggcgcgcggcctcgtgcagtactcc
tcgtcgcagctgcccgccatgctcgggcggacgaccgccgacctccgccaggacctcggc
gcgggctacgacggcgtcgtcgtgcacgccgacgactgggtgcgtctgactccgccgcag
cgctga

DBGET integrated database retrieval system