KEGG   Micrococcus luteus: Mlut_10960Help
Entry
Mlut_10960        CDS       T00918                                 

Definition
(GenBank) indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
mlu  Micrococcus luteus
Pathway
mlu00400  Phenylalanine, tyrosine and tryptophan biosynthesis
mlu01100  Metabolic pathways
mlu01110  Biosynthesis of secondary metabolites
mlu01130  Biosynthesis of antibiotics
mlu01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mlu00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Mlut_10960
Enzymes [BR:mlu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Mlut_10960
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS NanE
Motif
Other DBs
NCBI-ProteinID: ACS30603
UniProt: C5CBK6
Position
1170762..1171568
Genome map
AA seq 268 aa AA seqDB search
MSVLQEIIDGVREDLEPRRRDLPEARLAELVAAAPAPRDAHAALHGGRTDPAGIRVISEV
KRASPSKGALAEIPEPATLARAYERGGASAVSVLTEARRFGGSLADLDAVRAAVDLPVLR
KDFTVTEYQIHEARAHGADLVLLIVAALDDAELAGFLQLTESLGMHALVEAHTPEEIERG
VAAGARILGVNVRNLKTLDVDPARYAALADGLPEDVVRVAESGVESEAQIKAYAAAGADV
VLVGEALVRHGAPEEALRAFRAASLTVR
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
gtgtccgtcctccaggagatcatcgacggcgtccgcgaggacctcgagccacgtcgccgt
gacctgcccgaggcgcgcctggccgagctggtggccgccgcccccgcgccgcgtgacgcc
cacgcggccctgcacggcggacgcaccgaccccgcggggatccgggtgatctccgaggtg
aagcgggcgagcccctccaagggcgcgctcgccgagatccccgagccggccaccctggcc
cgcgcgtacgagcgcggcggcgccagcgccgtctccgtgctcaccgaggcccgccgcttc
ggcggcagcctggccgacctggacgccgtgcgcgccgccgtcgatctgccggtcctgcgc
aaggacttcaccgtcaccgagtaccagatccacgaggcccgcgcccacggggccgacctg
gtcctgctgatcgtggccgccctcgacgacgccgagctggccggcttcctgcagctcacc
gagtccctgggcatgcacgccctcgtggaggcccacacgcccgaggagatcgagcgcggc
gtcgccgccggcgcccgcatcctcggcgtcaacgtgcgcaacctcaagaccctggacgtc
gacccggcccgctacgccgcgctggccgacgggctgcccgaggacgtcgtccgggtcgcc
gagtcgggcgtcgagtccgaggcgcagatcaaggcctacgccgccgcaggcgccgacgtc
gtgctcgtgggcgaggccctcgtgcgccacggcgcccccgaggaggcgctgcgcgcgttc
cgcgccgcgtccctcaccgtccgctga

DBGET integrated database retrieval system