KEGG   Micrococcus luteus: Mlut_10970Help
Entry
Mlut_10970        CDS       T00918                                 

Definition
(GenBank) tryptophan synthase, beta chain (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
mlu  Micrococcus luteus
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mlu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Mlut_10970
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Mlut_10970
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Mlut_10970
Enzymes [BR:mlu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Mlut_10970
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1171598..1172923
Genome map
AA seq 441 aa AA seqDB search
MSADRPSTEPAIEFEGPYQGQAGPYFGDYGGQWMPESLMAALQELTRTYEEARQDPAFEA
ELRTLFRDYVNRPSLLTEVPRFAADTPGVRIFLKREDLNHTGSHKINNVIGQALLARRMG
KTRLIAETGAGQHGVATATAAALFGMECTVYMGEEDTRRQALNVARMQMLGAEVVPVAIG
ARTLKDAINEALRDWVASVDTTHYLMGTVTGPHPFPAMVRYFHSVIGEEAREQILAQAGR
LPDAVAACVGGGSNAMGLFHGFLDDPEVELYGFEAGGEGLETGRHAASITLGRTGVLHGA
RTYLMQDEDGQTIDSHSISAGLDYPAVGPEHAFLHDTGRAVYEPVSDTECMDAFLRLTRT
EGITPAIESAHALAGALRLARRWADEGLVGPDAPEGEERIIIVNLSGRGDKDVATAAAWF
GLGTAAEEKDPLEEMTPGEEQ
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atgagcgccgaccgtccgagcaccgagcccgcgatcgagttcgaggggccctatcagggt
caggccgggccctacttcggcgactacggcgggcagtggatgcccgagtccctcatggcc
gcgctgcaggagctcacccgcacctacgaggaggcgcggcaggaccccgccttcgaagcc
gagctgcggaccctgttccgggactacgtgaaccggccctccctgctgaccgaggtgccg
cggttcgccgcggatacccccggggtgcgcatcttcctcaagcgcgaggacctcaaccac
accggctcgcacaagatcaacaacgtgatcggccaggcgctgctcgcccgccgcatgggc
aagacgcgcctgatcgcggagaccggcgccggccagcacggcgtggccacggcgacggcg
gccgcgctgttcggcatggagtgcaccgtgtacatgggggaggaggacacccgccgccag
gccctgaacgtggcccgcatgcagatgctcggcgccgaggtggtgcccgtggcgatcggc
gcccgcaccctcaaggacgcgatcaacgaggccctgcgggactgggtcgcctccgtggac
accacgcattacctgatgggcacggtcacgggcccgcacccgttccccgccatggtgcgc
tacttccactccgtgatcggcgaggaggcccgcgagcagatcctggcgcaggccggccgc
ctgccggacgccgtcgcggcgtgcgtgggcggcgggtccaacgcgatgggcctgttccac
ggcttcctcgacgaccctgaggtggagctctacggcttcgaggccgggggcgagggcctc
gagaccggtcgccacgccgcgtccatcacgctcggacgcaccggcgtgctgcacggcgcc
cgcacgtacctgatgcaggacgaggacgggcagacgatcgactcccactcgatctccgcc
ggcctggactacccggccgtcggcccggagcacgccttcctgcacgacacgggccgcgcc
gtctacgagccggtctcggacaccgagtgcatggacgccttcctccggctcacgcgcacc
gagggcatcacgcccgccatcgagtcggcccacgccctggccggcgcgctgcgcctggcc
cgccgctgggcggacgagggcctcgtggggccggacgccccggagggggaggagcggatc
atcatcgtgaacctctccggccgcggggacaaggacgtcgccacggcggcggcctggttc
ggcctcggcacggccgcggaggagaaggacccgctcgaggagatgacccccggagaggag
cagtga

DBGET integrated database retrieval system