KEGG   Micrococcus luteus: Mlut_10970Help
Entry
Mlut_10970        CDS       T00918                                 

Definition
tryptophan synthase subunit beta (EC:4.2.1.20)
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
mlu  Micrococcus luteus
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mlu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Mlut_10970
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Mlut_10970
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Mlut_10970
Enzymes [BR:mlu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Mlut_10970
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1171598..1172923
Genome map
AA seq 441 aa AA seqDB search
MSADRPSTEPAIEFEGPYQGQAGPYFGDYGGQWMPESLMAALQELTRTYEEARQDPAFEA
ELRTLFRDYVNRPSLLTEVPRFAADTPGVRIFLKREDLNHTGSHKINNVIGQALLARRMG
KTRLIAETGAGQHGVATATAAALFGMECTVYMGEEDTRRQALNVARMQMLGAEVVPVAIG
ARTLKDAINEALRDWVASVDTTHYLMGTVTGPHPFPAMVRYFHSVIGEEAREQILAQAGR
LPDAVAACVGGGSNAMGLFHGFLDDPEVELYGFEAGGEGLETGRHAASITLGRTGVLHGA
RTYLMQDEDGQTIDSHSISAGLDYPAVGPEHAFLHDTGRAVYEPVSDTECMDAFLRLTRT
EGITPAIESAHALAGALRLARRWADEGLVGPDAPEGEERIIIVNLSGRGDKDVATAAAWF
GLGTAAEEKDPLEEMTPGEEQ
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atgagcgccgaccgtccgagcaccgagcccgcgatcgagttcgaggggccctatcagggt
caggccgggccctacttcggcgactacggcgggcagtggatgcccgagtccctcatggcc
gcgctgcaggagctcacccgcacctacgaggaggcgcggcaggaccccgccttcgaagcc
gagctgcggaccctgttccgggactacgtgaaccggccctccctgctgaccgaggtgccg
cggttcgccgcggatacccccggggtgcgcatcttcctcaagcgcgaggacctcaaccac
accggctcgcacaagatcaacaacgtgatcggccaggcgctgctcgcccgccgcatgggc
aagacgcgcctgatcgcggagaccggcgccggccagcacggcgtggccacggcgacggcg
gccgcgctgttcggcatggagtgcaccgtgtacatgggggaggaggacacccgccgccag
gccctgaacgtggcccgcatgcagatgctcggcgccgaggtggtgcccgtggcgatcggc
gcccgcaccctcaaggacgcgatcaacgaggccctgcgggactgggtcgcctccgtggac
accacgcattacctgatgggcacggtcacgggcccgcacccgttccccgccatggtgcgc
tacttccactccgtgatcggcgaggaggcccgcgagcagatcctggcgcaggccggccgc
ctgccggacgccgtcgcggcgtgcgtgggcggcgggtccaacgcgatgggcctgttccac
ggcttcctcgacgaccctgaggtggagctctacggcttcgaggccgggggcgagggcctc
gagaccggtcgccacgccgcgtccatcacgctcggacgcaccggcgtgctgcacggcgcc
cgcacgtacctgatgcaggacgaggacgggcagacgatcgactcccactcgatctccgcc
ggcctggactacccggccgtcggcccggagcacgccttcctgcacgacacgggccgcgcc
gtctacgagccggtctcggacaccgagtgcatggacgccttcctccggctcacgcgcacc
gagggcatcacgcccgccatcgagtcggcccacgccctggccggcgcgctgcgcctggcc
cgccgctgggcggacgagggcctcgtggggccggacgccccggagggggaggagcggatc
atcatcgtgaacctctccggccgcggggacaaggacgtcgccacggcggcggcctggttc
ggcctcggcacggccgcggaggagaaggacccgctcgaggagatgacccccggagaggag
cagtga

DBGET integrated database retrieval system