KEGG   Micrococcus luteus: Mlut_10980Help
Entry
Mlut_10980        CDS       T00918                                 

Definition
(GenBank) tryptophan synthase, alpha chain
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
mlu  Micrococcus luteus
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mlu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Mlut_10980
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Mlut_10980
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Mlut_10980
Enzymes [BR:mlu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Mlut_10980
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1172920..1173726
Genome map
AA seq 268 aa AA seqDB search
MTGMTVHSKTAAALDAAKAAGRTGLVAFLPAGYPSVDECVEAVVAAAENGADVIELGLPY
TDPVMDGPVIQAATQTALQAGFRVADVFDIIRRVTQRTDAAVLVMTYWNLVDRMGVDEFA
RRLAEAGGAGLVTPDLVPEEAGAWMEASDRHGLDRVFLTAPSSTDERVRLTVDSSRGFVY
AVSVMGVTGTRDTVSTVAETVVRRAQDAGAEHVCVGLGVSQAAHVREIGAYADGAIVGTA
LVRALTDGGPQAVGTLTRELAAGTVREG
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
gtgaccggcatgaccgtgcactccaagaccgccgcggccctggacgccgcgaaggcggcc
ggccgcaccggcctcgtcgccttcctgccggccggctacccgtccgtggacgagtgcgtc
gaggccgtcgtcgccgccgcggagaacggcgccgacgtcatcgagctgggcctgccctac
acggaccccgtgatggacggccccgtgatccaggccgcgacccagacggcgctgcaggcg
ggtttccgcgtggccgacgtcttcgacatcatccgacgggtgacccagcgcaccgacgcc
gcggtgctggtgatgacctactggaacctcgtggaccgcatgggcgtcgacgagttcgcg
cgccgcctcgcggaggccgggggcgccggtctcgtcacccctgacctcgtgcccgaggag
gccggcgcctggatggaggcctcggaccgtcacggcctggaccgcgtgttcctcaccgcg
ccctcgtccacggacgagcgggtgcgcctcaccgtcgactcctcccgcggcttcgtgtac
gccgtgtcggtcatgggcgtcaccggcacccgcgacacggtgtccaccgtcgccgagacc
gtggtccgccgggctcaggatgccggggcggagcacgtgtgcgtcggcctcggcgtctcc
caggcggcgcacgtccgcgagatcggcgcctacgccgacggcgcgatcgtcggcacggcc
ctggtgcgcgcgctgacggacggcgggccgcaggccgtggggacgctgacccgcgagctc
gccgccggcacggtccgagagggctga

DBGET integrated database retrieval system