KEGG   Micrococcus luteus: Mlut_11370Help
Entry
Mlut_11370        CDS       T00918                                 

Definition
(RefSeq) triosephosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
mlu  Micrococcus luteus
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:mlu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mlut_11370
   01230 Biosynthesis of amino acids
    Mlut_11370
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mlut_11370
   00051 Fructose and mannose metabolism
    Mlut_11370
   00562 Inositol phosphate metabolism
    Mlut_11370
Enzymes [BR:mlu01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Mlut_11370
Exosome [BR:mlu04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Mlut_11370
  Exosomal proteins of bladder cancer cells
   Mlut_11370
  Exosomal proteins of melanoma cells
   Mlut_11370
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1225031..1225822
Genome map
AA seq 263 aa AA seqDB search
MAEQTTRVPLIAGNWKMNLDHLEAVTLVQRLTWLLSDADHDQEAVEVAVFPPFTGLRSVQ
TLVTGDRLDLVYGAQDLSPEDAGAYTGDVSGAFLAALGCRYAIVGHSERRTLHGEDDALV
ARKAAAALRHGLTPVICVGEGLEVRQAGRHVEHTLAQLEGSIAGLSAQDVAGVVVAYEPV
WAIGTGEVAGPEDAQQMCAALRARVAALHGDDVAAGLRILYGGSVKSSSAPALLAQPDVD
GALVGGASLDADEFAKIVRFDQA
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atggcggagcagaccacacgcgtgccgctgatcgcgggcaactggaagatgaacctggac
cacctcgaggccgtcaccctggtgcagcgcctcacgtggctcctctcggacgcggaccat
gaccaggaggccgtggaggtcgcggtgttcccgcccttcacgggcctgcggtccgtgcag
acgctcgtcaccggcgaccgcctggacctcgtctacggcgcgcaggacctctcgcccgag
gatgccggcgcctacacgggcgacgtctccggcgcgttcctggccgcgctggggtgccgt
tacgcgatcgtgggccactccgagcgccgcaccctccacggggaggacgacgccctcgtc
gcgcgcaaggccgccgcggccctgcgccacggcctcaccccggtgatctgcgtgggcgag
ggcctggaggtgcgccaggccggccggcacgtcgagcacacgctcgcccagctggagggc
tccatcgcgggcctgtcggcgcaggacgtggccggcgtcgtcgtcgcctacgagcccgtg
tgggcgatcggcacgggcgaggtcgccggccccgaggatgcgcagcagatgtgtgcggcc
ctgcgcgcccgcgtggccgcactgcacggcgacgacgtcgccgccgggctgcggatcctc
tacggcggctccgtgaagtcctccagcgcgccggcgctgctggcacagcctgacgtggac
ggcgccctcgtgggcggcgccagcctcgacgcggacgagtttgctaagatcgtccggttc
gaccaggcctga

DBGET integrated database retrieval system