KEGG   Micrococcus luteus: Mlut_12550Help
Entry
Mlut_12550        CDS       T00918                                 

Definition
guanylate kinase (EC:2.7.4.8)
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
mlu  Micrococcus luteus
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:mlu00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Mlut_12550
Enzymes [BR:mlu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Mlut_12550
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1358904..1359554)
Genome map
AA seq 216 aa AA seqDB search
MTDTFDPGPAPAVPVARTAVQERPPGPGVTVLAGPTAVGKGTVSAYVREHYPEAWLSVSA
TTRPARPGEEDGVHYYFTTPEEFDSLVEADEMLEWAVVHGVHRYGTRRDRVMEAVAQGRH
VLLEIDLQGARQVRRALPEATFVFLAPPSWEELVSRLLGRGTESPEEQRRRLETARLELA
AEPEFDAVVVNDRVERAAEELVRLMGLDPERRPTEA
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgacacgttcgaccccggacccgcccccgccgtcccggtggcccgcaccgccgtc
caggaacgccccccgggcccgggcgtcaccgtcctggccggccccaccgccgtcggcaag
ggcaccgtgtcggcctatgtccgcgagcactaccccgaggcctggctgtccgtctccgcc
accacccgcccggcgcgcccgggcgaggaggacggggtgcactactacttcacgacgccg
gaggagttcgactccctcgtcgaggcggacgagatgctggaatgggccgtcgtgcacggc
gtccaccgctacggcacgcggcgcgaccgcgtgatggaggccgtggcgcagggccgccac
gtcctgctggagatcgacctgcagggagcgcgccaggtccgccgtgcgctgccggaggcc
accttcgtgttcctggcgccgccgagctgggaggaactcgtgtcccggctgctcggccgc
ggcaccgagagcccggaggaacagcgccgccggctcgaaacggctagactggaactcgcc
gcggaacccgagttcgacgccgtcgtcgtgaacgaccgcgtggagcgggccgccgaggaa
ctggtgagactcatggggctggaccccgagcgccgtccgaccgaggcctga

DBGET integrated database retrieval system