KEGG   Micrococcus luteus: Mlut_13330Help
Entry
Mlut_13330        CDS       T00918                                 

Definition
2-oxoglutarate dehydrogenase E2 component
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
mlu  Micrococcus luteus
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:mlu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mlut_13330
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Mlut_13330
  Amino acid metabolism
   00310 Lysine degradation
    Mlut_13330
Enzymes [BR:mlu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Mlut_13330
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1458736..1460565
Genome map
AA seq 609 aa AA seqDB search
MSETVNLPALGESVTEGTVTRWLKAVGDEVAVDEPLVEVSTDKVDTEIPSPVAGVLEEIL
VEEDDTVEVGAPLATIGGGSADTSEDDAAAEEPAVEEAQQDDVQQEPAGEPAPEERASTD
QGSNEAPSAGGDASEVTLPALGESVTEGTVTRWLKSVGDEVEVDEPLLEVSTDKVDTEIP
SPVAGTLLEIRAEEDDTVEVGAVLALVGSGSAGGGSAPSEGSSGQDEASAEEIEDKATEA
EAPEETEEAAEAAGVEKSEKTPEASPSEEASRRESAQGETAEAPSATEPGQGYVTPLVRR
LAHQNNVDLSTVRGTGVGGRIRKQDVLAAALASQAAADGSEAPAEQSSEAAAPSSAASAP
ATSSSVDPSVRGEVEKAPRIRQVIAQRMRESLDLSAQLTQVHEVDLTRIVKLRNKAKASF
QQQAGVNLTYLPFITKAVAEALKQHPKLNASLSKDNKEITYHASEDIAIAVDTEKGLLVP
VIKDAGSLNLTGLAQKIADVAERTRTNKISPDELSGGTFSITNIGSVGALFDTPIINQPQ
VAILGTGAIVKRPMVVTDADGNDSIAIRHMMYLSLTYDHRLVDGADAGRFLMTVRQRLEG
GEFANELGL
NT seq 1830 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaaaccgtgaacctgcccgccctgggcgaatccgtcaccgagggcaccgtgacc
cgctggctcaaggccgtcggcgacgaggtcgccgtcgacgagcccctggtggaggtctcc
accgacaaggtcgacaccgagatcccgtcccccgtggccggcgtgctcgaggagatcctg
gtcgaggaggacgacaccgtcgaggtcggcgccccgctggccacgatcggcggcggctcc
gccgacacgtcggaggacgacgccgcggccgaggagcccgccgtcgaggaggctcagcag
gacgatgtccagcaggagcccgccggcgagccggccccggaggagcgtgcctccaccgac
cagggctcgaacgaggccccgtcggccggcggcgatgcctccgaggtcaccctgcccgcg
ctgggcgagtccgtgaccgagggcaccgtgacccgctggctgaagtccgtcggcgacgag
gtcgaggtcgacgagccgctgctcgaggtctccaccgacaaggtcgacaccgagatcccc
tcccccgtggcgggcaccctcctggagatccgtgcggaggaggacgacaccgtcgaggtg
ggcgccgtcctcgcgctcgtcggctccggctccgccggcggcggctccgccccgtcggag
ggctcctccggccaggacgaggcgtccgccgaggagatcgaggacaaggcgaccgaggcc
gaggcccccgaggagaccgaggaggccgccgaggccgccggcgtcgagaagtcggagaag
acgcccgaggcgtccccgtccgaggaggcctcccggcgtgagtccgcgcagggcgagacc
gccgaggcgccctccgccaccgagcccggccagggctacgtgacaccgctggtgcgccgc
ctggcccaccagaacaacgtggacctgtccacggtccgcggcacgggcgtcggcggccgc
atccgcaagcaggacgtgctcgccgccgcgctggcctcgcaggccgccgcagacgggtcc
gaggctccggccgagcagtcctccgaggctgccgccccgtcgtcggccgcgtccgccccg
gccacgagctcctccgtggacccctcggtccgcggcgaggtggagaaggcgccgcgcatc
cgccaggtcatcgcccagcgcatgcgcgaatccctcgacctgtccgcccagctgactcag
gtgcacgaggtggacctcacccgcatcgtgaagctgcgcaacaaggccaaggcctccttc
cagcagcaggccggcgtgaacctgacgtacctgccgttcatcacgaaggccgtcgccgag
gccctcaagcagcaccccaagctgaacgcgtcgctctccaaggacaacaaggagatcacc
taccacgcgtccgaggacatcgcgatcgccgtggacacggagaaggggctgctggtgccc
gtcatcaaggacgccggctccctgaacctgacgggcctcgcccagaagatcgccgacgtg
gccgagcgcacccgcacgaacaagatctcgccggacgagctctcgggcggcacgttctcg
atcacgaacatcggttccgtgggcgcgctgttcgacacgccgatcatcaaccagccgcag
gtcgcgatcctgggcaccggtgcgatcgtgaagcgccccatggtggtgaccgacgcggac
ggcaacgactcgatcgccatccgccacatgatgtacttgtccctgacctacgaccaccgc
ctggtggacggggccgacgcgggccgcttcctgatgacggtgcgtcagcgtctcgagggc
ggcgagttcgccaacgagctgggtctctga

DBGET integrated database retrieval system