KEGG   Micrococcus luteus: Mlut_13470Help
Entry
Mlut_13470        CDS       T00918                                 

Definition
Polyphosphate glucokinase (EC:2.7.1.63)
Orthology
K00886  
polyphosphate glucokinase [EC:2.7.1.63]
Organism
mlu  Micrococcus luteus
Pathway
Glycolysis / Gluconeogenesis
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:mlu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mlut_13470
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mlut_13470
   00520 Amino sugar and nucleotide sugar metabolism
    Mlut_13470
Enzymes [BR:mlu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.63  polyphosphate---glucose phosphotransferase
     Mlut_13470
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1475417..1476241
Genome map
AA seq 274 aa AA seqDB search
MTTHTSTAQRSSKYPTTIGIDVGGTGMKGGLVRLGSGPKAGTLRGDRFRIPTPQPAMPEP
VAATLAAITAELDGREKAPKPSAPLGVCFPSIVKDGVCLSANNIDHTWIGTDLRGTFEEH
LRRPVTVVNDADAAGLAEARYGAGRGVRGLVHVITLGTGIGGAMIHDGMLVPNFEVGSLE
LDGVMAESRASAKARERDQLSWAEYAERLQRFFSHVERIFSPDLFIVGGGISKRPDDYLP
LLRLRTPIVPAQLQNNAGIVGAALAAHGSLADGN
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
gtgacgacgcacaccagcaccgcccagcgctcctccaagtaccccacgacgatcggcatc
gacgtcggggggaccggcatgaagggcggcctggtccgcctcgggtcggggccgaaggcg
ggcaccctgcgcggggaccgcttccgcatccccaccccgcagccggccatgcccgagccc
gtggcggcgaccctggcggccatcaccgccgagctcgacgggcgcgagaaggcgccgaag
ccctccgccccgctcggcgtgtgcttcccctcgatcgtcaaggacggggtgtgcctgtcc
gcgaacaacatcgaccacacgtggatcggcacggacctgcgcggcacgttcgaggagcac
ctgcgccgccccgtcaccgtggtcaacgacgccgacgccgccggcctcgcggaggcccgc
tacggagccgggcggggcgtgcgcggcctggtgcacgtgatcaccctcgggaccggcatc
ggcggcgcgatgatccacgacggcatgctcgtcccgaacttcgaggtcggctcgctggag
ctcgacggcgtgatggccgagtcgcgggcctccgcgaaggcccgggagcgcgatcagctc
agctgggccgagtacgccgagcgactgcagcgcttcttctcccacgtggagcggatcttc
tcgcccgacctgttcatcgtcggcggcggcatctccaagcggccggacgactacctgccg
ctgctgcgcctgcgcaccccgatcgtcccggcccagctgcagaacaacgcgggcatcgtg
ggcgccgccctggccgcgcacggctcgctcgccgacggcaactga

DBGET integrated database retrieval system