KEGG   Micrococcus luteus: Mlut_13650Help
Entry
Mlut_13650        CDS       T00918                                 

Definition
UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
mlu  Micrococcus luteus
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:mlu00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    Mlut_13650
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Mlut_13650
Enzymes [BR:mlu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     Mlut_13650
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1495984..1497741)
Genome map
AA seq 585 aa AA seqDB search
MTTPSDPPAPLTPAQQDAAFRPSHTPATPWPVLAQALAEAGIAAHVHGAAPADGVTGVSL
DSRVVRPGDLYVAVPGARAHGAAFAATALEAGAVGVLTDAAGRALLAGQGLADVPVLEVD
AVRTAAGTVAARVYGGGGDAGPRLVGVTGTNGKTTTSFLSAALLEALGRRSGIVGTILIR
AGEREVPSTLTTPEATQLHALMALMREEQVDTAVMEVSSHAVAYQRIAGLRYAVAGFTNL
TQDHLDMHGSMQEYFAAKAGLFDPARTDHAVITLDGGEGPRWGVAMARAAGAPVTTLALG
PAAPTPGALAEHDPGLRADWEVAELAPDGLGHRFTLRHAATGRELRASVGLPGRFNVANA
ALAVLLVLHAVGEEHLDALAAVLDVPAGEGPLAAAVPGRMEVVGREPDAVVDFAHNPDGM
VQALRSLADARAAAGTRGRTLIVFGSAGDRDRDKRPVMGAIAARAADVVIVTDDTPHSED
PAPIRAHILAGARAEADRIAREEGRTVVIEEVADRFAAIRRAVELAGPQDGILLAGRGHE
TTMDYDGELVPLDDRVALREALAAGAAVASASVSGPVREGKVIES
NT seq 1758 nt NT seq  +upstreamnt  +downstreamnt
atgaccaccccgagcgacccccctgctccgctgacccccgcccagcaggacgccgccttc
cggccctcccacacccccgccacgccctggcccgtcctcgcgcaggcgctggccgaggcg
gggatcgcggcccacgtccacggcgcggccccggccgacggcgtcacgggggtcagcctc
gactcgcgtgtcgtgcgcccgggcgacctctacgtcgccgttccgggggcgcgcgcccac
ggtgcggcgttcgcggccacggcgctggaggccggcgccgtcggcgtcctgacggacgcg
gcgggccgcgcgctcctggcggggcagggcctggccgacgtcccggtgctcgaggtcgac
gccgtgcgcaccgccgccggcaccgtggcggcccgcgtctacggcggcgggggcgacgcc
ggcccgcgcctggtcggcgtgaccggcaccaacggcaagaccaccacgagcttcctctcc
gccgccctgctcgaggccctggggcgccggtcgggcatcgtgggcacgatcctgatccgc
gcgggggagcgggaggtcccctccacgctcaccacgcccgaggccacccagctgcacgcc
ctcatggcgctcatgcgcgaggagcaggtggacaccgccgtcatggaggtctcctcccac
gccgtggcgtaccagcggatcgccggcctgcgctacgcggtggccgggttcaccaacctg
acccaggaccacctggacatgcacggctcgatgcaggagtacttcgcggccaaggccggt
ctgttcgaccccgcccgcaccgaccacgccgtcatcacgctcgacggcggcgagggaccc
cgctggggcgtcgccatggcccgggccgccggcgctcccgtcaccacgctcgccctcggg
ccggccgcgccgacgccgggcgccctggccgaacacgaccccggcctccgggctgactgg
gaggtcgccgagctcgcgccggacggcctcggccaccgtttcaccctgcgccacgcggcc
acgggccgggagctgcgggcctccgtcggtctgccgggccgcttcaacgtggccaacgcg
gccctcgcggtcctgctcgtgctgcacgccgtgggggaggagcacctggacgcgctcgcc
gccgtcctggacgtgcccgcgggcgagggccctctggccgccgccgtcccggggcggatg
gaggtcgtgggccgcgagccggacgccgtcgtcgacttcgcgcacaacccggacggcatg
gtccaggcgctgcgctccctcgccgacgcccgggcggcggccgggacgcgcggccgcacc
ctgatcgtgttcggctccgccggcgaccgtgaccgtgacaagcggcccgtgatgggcgcg
atcgcggcccgggcggcggatgtggtgatcgtcaccgacgacaccccccactcggaggac
ccggcgccgatccgcgcccacatcctggccggcgcccgcgccgaggccgaccgcatcgcg
cgggaggagggccgcacggtcgtgatcgaggaggtggccgaccgtttcgcggccatccgc
cgcgccgtggagctggcggggccgcaggacggcatcctcctggccggccgcgggcacgag
accacgatggactacgacggcgagctcgtcccgctggacgatcgggtggccctgcgcgag
gccctggccgccggtgccgctgtggcctccgcctcggtctccggcccagtccgcgagggt
aaggtcatcgagtcatga

DBGET integrated database retrieval system