KEGG   Micrococcus luteus: Mlut_13780Help
Entry
Mlut_13780        CDS       T00918                                 

Definition
esterase/lipase
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
mlu  Micrococcus luteus
Brite
Enzymes [BR:mlu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     Mlut_13780
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1511180..1511950
Genome map
AA seq 256 aa AA seqDB search
MPRPVAVAPEDLPLRLMPAAPARRDHCVVLLHGFTSTPASVRAWAEGLAAGGSPVSVPLL
PGHGTRWEDLAATGADEIRAAVRAVVDLELARHGRVVMAGISMGGALALDAAAHRPVAGV
LVVNPALRFASPLAPFAPLLAPFVPTVDPIADDIADPTARERAYPRTPTAGVAALGRIQR
AARRALPQITAPVTVYRSARDAVVPASSHRTLVRGLRQAPVEVVGLPRSRHVATLDYDLP
LLIDHGRSAVAAMTTH
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgccccgccccgtcgccgtcgcccccgaggacctccccctgcgcctcatgcccgccgct
cccgcccggcgcgaccactgcgtcgtgctcctgcacgggttcacctcgactccggcctcc
gtccgcgcctgggccgaggggctcgcggcaggcggctcccccgtgagcgtgcccctgctg
ccggggcacggcacccggtgggaggacctggccgccaccggtgcggacgagatccgcgcc
gccgtccgggccgtcgtggacctcgagctcgcccgacacggccgcgtggtcatggcgggc
atctcgatgggcggcgccctcgcgctcgacgccgcggcccaccgacccgtggccggggtg
ctcgtggtgaaccccgcgctgcgcttcgccagcccgctcgcccccttcgccccgctgctg
gccccgttcgtccccacggtcgacccgatcgcggacgacatcgcggacccgacggcgcgc
gagcgcgcctacccccgcacgccgacggccggcgtcgccgccctcggccgcatccagcgg
gccgcccgccgcgccctgccgcagatcacggcgcccgtgacggtctaccggtccgcccgc
gacgccgtcgtgcccgcctcgagccaccggaccctggtgcggggcctgcgccaggccccc
gtggaggtggtgggactgccccgcagccgccacgtcgccacgctcgactacgacctgccg
ctgctgatcgaccacggccggagcgcggtcgccgccatgacgacgcactga

DBGET integrated database retrieval system